
|
Name : ebr (ABAYE3569) Accession : YP_001715320.1 Strain : Acinetobacter baumannii AYE Genome accession: NC_010410 Putative virulence/resistance : Resistance Product : ethidium bromide resistance protein (E1 protein) Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2076 EC number : - Position : 3620981 - 3621328 bp Length : 348 bp Strand : - Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; Product type t : transporter DNA sequence : ATGAAAGGCTGGCTTTTTCTTGTTATCGCAATAGTTGGCGAAGTAATCGCAACATCCGCATTAAAATCTAGCGAGGGCTT TACTAAGCTTGCCCCTTCCGCCGTTGTCATAATCGGTTATGGCATCGCATTTTATTTTCTTTCTCTGGTTCTGAAATCCA TCCCTGTCGGTGTTGCTTATGCAGTCTGGTCGGGACTCGGCGTCGTCATAATTACAGCCATTGCCTGGTTGCTTCATGGG CAAAAGCTTGATGCGTGGGGCTTTGTAGGTATGGGGCTCATAATTGCTGCCTTTTTGCTCGCCCGATCCCCATCGTGGAA GTCGCTGCGGAGGCCGACGCCATGGTGA Protein sequence : MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLKSIPVGVAYAVWSGLGVVIITAIAWLLHG QKLDAWGFVGMGLIIAAFLLARSPSWKSLRRPTPW |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| qacEdelta1 | CAJ77052.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 2e-46 | 100 |
| ebr | YP_006098377.1 | putative ethidium bromide resistance protein | Not tested | Tn2411 | Protein | 2e-46 | 100 |
| qacEdelta1 | AGK07109.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-46 | 100 |
| qacEdelta1 | AGF35028.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-46 | 100 |
| qacEdelta1 | CAJ77088.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 2e-46 | 100 |
| qacEdelta1 | ACN81026.1 | QacEdelta1 | Not tested | AbaR5 | Protein | 2e-46 | 100 |
| qacEdelta1 | AFV53123.1 | QacEdelta1 multidrug exporter | Not tested | AbGRI2-1 | Protein | 2e-46 | 100 |
| qacEdelta1 | AGF35063.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-46 | 100 |
| qacE-deltal | ACF06159.1 | quartenary ammonium compound resistance protein | Not tested | Tn5036-like | Protein | 2e-46 | 100 |
| qacEdelta1 | AAK02047.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 2e-46 | 100 |
| qacEdelta1 | AGK36647.1 | QacEdelta1 | Not tested | AbaR26 | Protein | 2e-46 | 100 |
| qacEdelta1 | AGK06933.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-46 | 100 |
| qacE-delta1 | ACY75523.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 2e-46 | 100 |
| qacEdelta1 | AAK02056.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 2e-46 | 100 |
| qacEdelta1 | AGK06970.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-46 | 100 |
| qacE-delta1 | ACY75532.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 2e-46 | 100 |
| qacEdelta1 | ABB48428.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-46 | 100 |
| qacEdelta1 | AGK06979.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-46 | 100 |
| qacEdelta1 | ABZ01839.1 | QacEdelta1 | Not tested | SGI2 | Protein | 2e-46 | 100 |
| ACICU_00227 | YP_001844886.1 | membrane transporter | Not tested | AbaR20 | Protein | 2e-46 | 100 |
| qacEdelta1 | AGK07016.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-46 | 100 |
| qacE-delta1 | AET25389.1 | QacE-delta1 | Not tested | PAGI-2(C) | Protein | 2e-46 | 100 |
| qacEdelta1 | CAJ77030.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 2e-46 | 100 |
| qacEdelta1 | YP_005797134.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 2e-46 | 100 |
| qacEdelta1 | AGK07074.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-46 | 100 |
| qacE-delta1 | AFG30112.1 | QacE-delta1 | Not tested | PAGI-2 | Protein | 2e-46 | 100 |
| qacEdelta1 | CAJ77049.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 2e-46 | 100 |
| qacEdelta1 | YP_005797150.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 2e-46 | 100 |
| qacEdelta1 | AGK07100.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-46 | 100 |
| qacEdelta1 | AGF34989.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-46 | 100 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | BAC0323 | Protein | 7e-47 | 100 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | BAC0322 | Protein | 5e-38 | 89 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | BAC0324 | Protein | 3e-31 | 72 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | CP001138.1.gene1489. | Protein | 3e-18 | 56 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | BAC0377 | Protein | 2e-17 | 54 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | NC_010410.6003348.p0 | Protein | 2e-21 | 51 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | BAC0002 | Protein | 2e-21 | 51 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | CP004022.1.gene1549. | Protein | 2e-18 | 50 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | BAC0329 | Protein | 4e-15 | 47 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | BAC0327 | Protein | 5e-14 | 46 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | BAC0249 | Protein | 5e-09 | 46 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | AE000516.2.gene3301. | Protein | 5e-09 | 46 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | BAC0325 | Protein | 3e-13 | 46 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | BAC0192 | Protein | 2e-14 | 46 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | NC_002695.1.913273.p | Protein | 2e-13 | 44 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | BAC0150 | Protein | 1e-13 | 44 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | BAC0139 | Protein | 2e-14 | 44 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | BAC0140 | Protein | 3e-13 | 42 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | BAC0321 | Protein | 3e-15 | 42 |
| ebr | YP_001715320.1 | ethidium bromide resistance protein (E1 protein) | BAC0326 | Protein | 3e-14 | 42 |