Gene Information

Name : ABAYE1340 (ABAYE1340)
Accession : YP_001713256.1
Strain : Acinetobacter baumannii AYE
Genome accession: NC_010410
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1399946 - 1400632 bp
Length : 687 bp
Strand : +
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr : regulator

DNA sequence :
ATGAGTCTCTACAAAATGCGTATTCTTATTATTGAAGACGAGATCAAAATCGCCACTTATTTGGTCAAAGGGTTAAAAGA
ATCCGGATACCAAGCCGAGTGCGTACATTTAGGACTTCAAGGTTTGGAAATGCTAAAAAGAGATCAATATGACTTGCTTA
TTCTTGATGTGATGTTGCCGGACATAGAGGGCTGGAGCGTACTACAGGTACTACGCCAGTTTTCAAAAATTCCGGTGATT
TTCTTAACGGCAAAAGATCAGGTCATGGATAGAGTGAAAGGGTTAGAGTTAGGTGCAGATGACTACTTGGCTAAACCCTT
TTCCTATATTGAACTCTTGGCACGCATTAAAAGTTTGTTAAGACGACAGCAGTATTTGCAAGAAAATGAGTTGTCTATAA
GTGATCTAAAAATGGATTTGGTGGGGCATAAAGTATGGCGTAATGGCAACTTAATCGAACTGAGTAAAACCGAATTTAAC
TTATTACGTTATTTATTGGTCAATAAAGAACAAATCGTGACGCGTAGACAAATCGGTTCTGAGGTTTGGAATATTAACTT
TGACACCGATACCAACTTTATTGACGTTGCAGTACGCCGTTTAAGAAGCAAAATTGATGAAGGATATGAACCAAAACTTA
TCCATACCATCCGTGGCTTGGGCTATAAAATTTCGGTTAGCTTATGA

Protein sequence :
MSLYKMRILIIEDEIKIATYLVKGLKESGYQAECVHLGLQGLEMLKRDQYDLLILDVMLPDIEGWSVLQVLRQFSKIPVI
FLTAKDQVMDRVKGLELGADDYLAKPFSYIELLARIKSLLRRQQYLQENELSISDLKMDLVGHKVWRNGNLIELSKTEFN
LLRYLLVNKEQIVTRRQIGSEVWNINFDTDTNFIDVAVRRLRSKIDEGYEPKLIHTIRGLGYKISVSL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-49 50
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-48 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator BAC0308 Protein 1e-52 54
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator BAC0197 Protein 2e-58 54
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator BAC0125 Protein 6e-57 52
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator BAC0111 Protein 5e-56 50
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator BAC0083 Protein 8e-54 50
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-49 50
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator BAC0347 Protein 2e-51 48
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 2e-34 44
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 2e-34 44
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 2e-34 44
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 2e-34 44
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 2e-34 44
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 2e-34 44
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 2e-34 44
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 2e-34 44
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 3e-29 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator VFG0596 Protein 4e-50 50
ABAYE1340 YP_001713256.1 two component heavy metal response transcriptional regulator VFG1390 Protein 4e-38 43