Gene Information

Name : MAB_2875 (MAB_2875)
Accession : YP_001703608.1
Strain : Mycobacterium abscessus ATCC 19977
Genome accession: NC_010397
Putative virulence/resistance : Resistance
Product : Beta-lactamase precursor (Penicillinase)
Function : -
COG functional category : V : Defense mechanisms
COG ID : COG2367
EC number : -
Position : 2927879 - 2928748 bp
Length : 870 bp
Strand : +
Note : Similar to Q670S6_PSELU 2e-65

DNA sequence : 
ATGATCTCTCGTCGCGCACTTCTTGTCGGTGGGGTATCGGCGGTCGGTGTGGTGGCTGCCGGTTGTTCGCGCAACGGCAA
CCGTCGGCCCGCGCCGGACGAACTCGCCTCGCTGGAAAAGGATTTCGGCGGCCGCATCGGTGTCTACGCGTTGGACACCG
GGTCGGGTGACACGGTCGGCCACCGCGCCGATGAACGCTTTCTGATGTGCTCAACGGTCAAGACCTTCATCGTCTCGGCC
ATCCTGCGCCGGAGACTGAGCGAACCGGGCCTGTTGGACCAGCGAATTCAGTACACGCAATCCGACGTTCTGGAATGGGC
GCCGATCACCTCGCAACACGTGTCCACCGGAATGACCGTCTCGGAACTGTGTGATGCGACGCTCCGCTATAGCGACAACA
CCGGTGCCAACCTGCTGATCACCCAACTCGGCGGCCCGAAGGAGACAGAGAAGTTCGTCCGAAGCCTGGGCGACAACGTC
ACTCGCATGGACCGCACGGAGGTACAGCTGAACATCCCCGACGGCGATCTGGATACCTCGACCCCGCAGCAGCTGGTGGC
CAATCTGCGCCGACTGGTCCTCGACGAAGGGCTGGATTCACGGGGACGGGATCTGCTGACCGATTGGTTGAAGCGAAATA
CCACCGGCGACCAGTCCATTCGGGCAGCAGTTCCCGCCGGGTGGACGGTCGCAGACAAGACCGGCGGCGGCTTCAAGGGT
GAAACCAACGACATCGCGGTGATCTGGCCCCCGGGCCGTGCACCCATCGTGATGGCGGTACTCACCGTCCCGGAGGACCC
CACATCCACCAAAGGTAAGCCGACGATTGCCGCGGCCACCCGAATCGTGCTGCGGGCCTTCGGCGCTTGA

Protein sequence : 
MISRRALLVGGVSAVGVVAAGCSRNGNRRPAPDELASLEKDFGGRIGVYALDTGSGDTVGHRADERFLMCSTVKTFIVSA
ILRRRLSEPGLLDQRIQYTQSDVLEWAPITSQHVSTGMTVSELCDATLRYSDNTGANLLITQLGGPKETEKFVRSLGDNV
TRMDRTEVQLNIPDGDLDTSTPQQLVANLRRLVLDEGLDSRGRDLLTDWLKRNTTGDQSIRAAVPAGWTVADKTGGGFKG
ETNDIAVIWPPGRAPIVMAVLTVPEDPTSTKGKPTIAAATRIVLRAFGA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
blaCTX-M2 ACF06162.1 beta-lactamase CTX-M2 Not tested Tn5036-like Protein 3e-50 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) EU555534.1.gene1.p01 Protein 2e-57 52
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) FJ234412.1.gene1.p01 Protein 2e-57 52
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) GQ140348.1.gene1.p01 Protein 1e-56 52
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY034847.1.gene1.p01 Protein 9e-57 52
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF395881.gene.p01 Protein 8e-57 52
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) EU729727.1.gene1.p1 Protein 1e-56 52
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF297554.1.gene1.p1 Protein 9e-57 52
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) HM066995.1.gene1.p01 Protein 2e-56 52
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) HQ641421.1.gene1.p01 Protein 2e-56 51
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) HQ833651.1.gene1.p01 Protein 3e-51 46
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) JF274247.1.gene1.p01 Protein 8e-51 46
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) HM755448.1.gene1.p01 Protein 6e-51 46
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) FJ907381.1.gene1.p01 Protein 8e-51 46
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) EU545409.1.gene1.p1 Protein 4e-51 46
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF189721.1.gene1.p01 Protein 4e-49 46
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AM982522.2.gene1.p01 Protein 4e-50 46
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) DQ663489.gene.p01 Protein 9e-49 46
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY157676.1.gene1.p01 Protein 2e-51 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) GQ870432.1.gene1.p1 Protein 2e-51 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) HM167760.1.gene1.p01 Protein 3e-51 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY954516.1.gene1.p1 Protein 7e-51 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) FJ971899.1.gene1.p1 Protein 2e-51 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF518567.2.gene4.p01 Protein 2e-51 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) DQ023162.1.gene1.p1 Protein 1e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) GQ149243.1.gene1.p01 Protein 9e-51 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) GQ149244.1.gene1.p01 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) U95364.1.gene1.p01 Protein 7e-51 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) DQ125241.gene.p01 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) DQ408762.1.gene1.p1 Protein 4e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) HM776707.1.gene1.p1 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AJ416344.1.gene1.p01 Protein 4e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) X92507.1.gene1.p01 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AJ567481.1.gene1.p01 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) GU127598.1.gene1.p1 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY033516.1.gene2.p01 Protein 1e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) HQ913565.1.gene1.p01 Protein 7e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) FJ214367.1.gene1.p1 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY822595.1.gene1.p01 Protein 6e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF325133.1.gene1.p1 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) HQ398215.1.gene1.p01 Protein 8e-51 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY847146.1.gene1.p01 Protein 4e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY156923.1.gene1.p01 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY029068.1.gene1.p1 Protein 5e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) JF274243.1.gene1.p01 Protein 1e-49 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY847144.1.gene1.p01 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) FJ214366.1.gene1.p1 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF325134.1.gene1.p1 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AJ416345.gene.p01 Protein 6e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF252622.2.gene2.p01 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) FJ214369.1.gene1.p1 Protein 6e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) HQ166709.1.gene1.p01 Protein 1e-49 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) DQ211987.1.gene1.p01 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY847145.1.gene1.p01 Protein 4e-49 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) EF581888.1.gene1.p01 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) FJ214368.1.gene1.p1 Protein 5e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) EU136031.3.gene1.p3 Protein 1e-49 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) JF274246.1.gene1.p01 Protein 7e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY847143.1.gene1.p01 Protein 2e-49 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF252623.2.gene1.p01 Protein 9e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY847147.1.gene1.p01 Protein 4e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF174129.3.gene9.p01 Protein 6e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) JF274242.1.gene1.p01 Protein 1e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY143430.1.gene1.p01 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) HQ833652.1.gene1.p01 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY750914.gene.p01 Protein 2e-49 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) EF418608.1.gene1.p01 Protein 6e-51 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) HM803271.1.gene1.p01 Protein 1e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY303807.gene.p01 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) EF426798.1.gene1.p1 Protein 1e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) JF966749.1.gene1.p01 Protein 1e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) DQ810789.1.gene1.p01 Protein 1e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) X92506.gene.p01 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) DQ223685.1.gene1.p01 Protein 1e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF488377.1.gene1.p1 Protein 8e-51 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AJ557142.gene.p01 Protein 1e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) EF210159.1.gene1.p01 Protein 1e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AM411407.1.gene1.p01 Protein 1e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) EF219142.1.gene1.p01 Protein 2e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) EU402393.1.gene1.p1 Protein 9e-51 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) GQ351346.1.gene1.p01 Protein 7e-51 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) DQ885477.1.gene1.p01 Protein 1e-50 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) DQ268764.2.gene6.p01 Protein 8e-51 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AB284167.2.gene1.p01 Protein 2e-49 45
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AJ005045.gene.p01 Protein 6e-49 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) Y14156.1.gene1.p01 Protein 2e-49 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) EF374097.1.gene1.p01 Protein 2e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) DQ102702.1.gene1.p1 Protein 8e-51 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AB205197.1.gene1.p01 Protein 2e-49 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) DQ328639.gene.p01 Protein 2e-48 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY005110.1.gene1.p1 Protein 2e-48 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) FJ815436.1.gene1.p01 Protein 1e-49 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY515297.1.gene1.p1 Protein 8e-49 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY238472.1.gene1.p01 Protein 2e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) DQ256091.1.gene1.p1 Protein 4e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF255298.1.gene1.p1 Protein 7e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF305837.gene.p01 Protein 3e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) JN227085.1.gene1.p01 Protein 1e-49 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) EU202673.2.gene1.p2 Protein 4e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AJ549244.1.gene1.p01 Protein 3e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY292654.1.gene1.p1 Protein 5e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) DQ061159.1.gene1.p01 Protein 2e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) Y10278.1.gene1.p01 Protein 4e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) FJ873739.1.gene1.p01 Protein 6e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY649755.1.gene1.p01 Protein 8e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY267213.1.gene1.p01 Protein 4e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY598759.gene.p01 Protein 7e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY847148.1.gene1.p01 Protein 4e-49 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) EU177100.1.gene1.p01 Protein 3e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) HQ398214.1.gene1.p01 Protein 7e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY995206.gene.p01 Protein 3e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY080894.1.gene1.p01 Protein 4e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AJ704396.1.gene1.p01 Protein 2e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AB177384.1.gene1.p01 Protein 5e-50 44
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF275256.gene.p01 Protein 2e-50 43
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) Z28968.gene.p01 Protein 7e-50 43
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF367983.gene.p01 Protein 7e-53 43
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) U50278.1.gene2.p01 Protein 2e-47 42
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AY130282.1.gene1.p1 Protein 5e-38 41
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) JF949915.1.gene1.p01 Protein 4e-37 41
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) JF949916.1.gene1.p01 Protein 1e-37 41
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) JN416112.1.gene1.p01 Protein 3e-39 41
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF347054.1.gene1.p1 Protein 1e-37 41
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) EF468463.1.gene1.p01 Protein 5e-38 41
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) FJ873740.1.gene1.p01 Protein 3e-39 41
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF190693.1.gene1.p01 Protein 2e-39 41
MAB_2875 YP_001703608.1 Beta-lactamase precursor (Penicillinase) AF427130.1.gene1.p01 Protein 6e-38 41