Gene Information

Name : Bsph_0322 (Bsph_0322)
Accession : YP_001696081.1
Strain : Lysinibacillus sphaericus C3-41
Genome accession: NC_010382
Putative virulence/resistance : Resistance
Product : general stress protein 16U (GSP16U)
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 342173 - 342754 bp
Length : 582 bp
Strand : +
Note : -

DNA sequence :
ATGGGTATTTCACTACAAAAAGGTCAAAAGGTAGATTTAACGAAAACAAATCCGGGATTAACAAATGTAATTGTTGGTTT
AGGTTGGGATACAAATAAATATGATGGTGGAAATGATTTTGATTTAGATTCCTCTGTATTTTTACTTGCCGATACAGGAA
AAGTAGCAGATCAAAATGACTTTATTTTCTACAACAATACAACAGGCGGTAACGGATCAGTTGAACATTCAGGTGACAAT
TTAACAGGTATTGGTGAAGGTGACGATGAAGTGGTGAAAGTTGCATTAGCTCAAGTTCCTGCCCATGTTCAACGACTTGC
ATTCACTGTAACTATTCATGATGCAGAGTCACGCAATCAAAACTTCGGTATGGTATCGAATGCATACATTCGCATTGTAA
ATGCTGCATCCAACCAAGAACTAATTCGCTATGATTTAGGTGAGGACTTCAGTATTGAAACAGCTATTGTAGTTGGTGAA
TTATATCGTCATAACGGAGAATGGAAATTTAACGCAGTAGGTGCTGGCTATCAAGGTGGCTTAGCTGCTTTATGTAATGA
CTACGGCTTGAACGTAAACTAA

Protein sequence :
MGISLQKGQKVDLTKTNPGLTNVIVGLGWDTNKYDGGNDFDLDSSVFLLADTGKVADQNDFIFYNNTTGGNGSVEHSGDN
LTGIGEGDDEVVKVALAQVPAHVQRLAFTVTIHDAESRNQNFGMVSNAYIRIVNAASNQELIRYDLGEDFSIETAIVVGE
LYRHNGEWKFNAVGAGYQGGLAALCNDYGLNVN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-56 61
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-54 59
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-55 59
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-55 59
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-51 56
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-49 55
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-49 55
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-49 55
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-26 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-26 42
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bsph_0322 YP_001696081.1 general stress protein 16U (GSP16U) BAC0389 Protein 1e-54 59
Bsph_0322 YP_001696081.1 general stress protein 16U (GSP16U) BAC0390 Protein 3e-54 56
Bsph_0322 YP_001696081.1 general stress protein 16U (GSP16U) BAC0392 Protein 2e-26 41