Gene Information

Name : FMG_0591 (FMG_0591)
Accession : YP_001691899.1
Strain : Finegoldia magna ATCC 29328
Genome accession: NC_010376
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 652419 - 653135 bp
Length : 717 bp
Strand : -
Note : -

DNA sequence :
TTGGGTAATATTCTCAGTTACTGGCGAAAGATACGAGGAAAATGCACAATGATTTGCTGTGTGGAAGATGACAAAAGCAT
AAGAGAATTAATTATCTACGCACTTAATAATGAAGGCTACGATGCAATGGGATTTGGAGACTATGGAGAATTCAAATCCA
CATTGTATTCTTCTAGTATAGATTTAATTATTCTAGATATTATGCTTCCGGGAAAAAGCGGGCTTGAAATTTTAAAAGAA
ATCAGAAATAATGAAAAAACAAAAAACATCCCAGTAATGATGCTTACTGCCAAGACTACAGAATACGATAAAATAGTGGG
TCTTGATAGTGGCGCTGATGATTATATGATCAAACCTTTTAGTATTATGGAACTACTAGCAAGAGTCAGAGCACTACTAA
GAAGATCCTCACTAAGTAAAACAAAATCTAAAATTATCTATAAGAATATTGAATTAGATTATGATAAAAGAACTGTTAGT
GTTGATGGAGAAAATGTAGAATTAACTTACAAGGAATTTGAATTACTGTACTATCTCCTATCAAATGTCGGCAAAGTTTT
GACTAGAGAAAATATCATGACCAAAATCTGGGGATTCGATTTTGAAGGAGAATCACGTACAGTTGATGTTCATATAGCAA
CTTTAAGGCAAAAACTTAAAAACGCTTCTAGCATAATCAAAACGATAAGAAATCTAGGATATAAAGCTGGTGAATGA

Protein sequence :
MGNILSYWRKIRGKCTMICCVEDDKSIRELIIYALNNEGYDAMGFGDYGEFKSTLYSSSIDLIILDIMLPGKSGLEILKE
IRNNEKTKNIPVMMLTAKTTEYDKIVGLDSGADDYMIKPFSIMELLARVRALLRRSSLSKTKSKIIYKNIELDYDKRTVS
VDGENVELTYKEFELLYYLLSNVGKVLTRENIMTKIWGFDFEGESRTVDVHIATLRQKLKNASSIIKTIRNLGYKAGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 7e-21 44
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-20 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FMG_0591 YP_001691899.1 two-component response regulator AE015929.1.gene1106. Protein 2e-17 46
FMG_0591 YP_001691899.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-21 45
FMG_0591 YP_001691899.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-21 45
FMG_0591 YP_001691899.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-21 45
FMG_0591 YP_001691899.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-21 45
FMG_0591 YP_001691899.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-21 45
FMG_0591 YP_001691899.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-21 45
FMG_0591 YP_001691899.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-21 45
FMG_0591 YP_001691899.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-21 45
FMG_0591 YP_001691899.1 two-component response regulator AF310956.2.orf0.gene Protein 3e-21 44
FMG_0591 YP_001691899.1 two-component response regulator U35369.1.gene1.p01 Protein 2e-20 43
FMG_0591 YP_001691899.1 two-component response regulator AE016830.1.gene2255. Protein 2e-20 43
FMG_0591 YP_001691899.1 two-component response regulator HE999704.1.gene1528. Protein 7e-21 42
FMG_0591 YP_001691899.1 two-component response regulator FJ349556.1.orf0.gene Protein 9e-20 41
FMG_0591 YP_001691899.1 two-component response regulator CP000675.2.gene1535. Protein 2e-17 41