Gene Information

Name : Caul_4546 (Caul_4546)
Accession : YP_001686164.1
Strain : Caulobacter sp. K31
Genome accession: NC_010338
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4921458 - 4922150 bp
Length : 693 bp
Strand : -
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: ccr:CC_0294 phosphate regulon response regulator PhoB

DNA sequence :
GTGACTCCGTACGTTCTGGTGGTCGAAGACGAAGACGCCCTGGCCACCCTGCTGCACTACAACCTCGACAAGGAAGGCTA
TGTCGTCGGCGTGGCCGGCGACGGCGAGGAGGCCCTGACCATGGCCTCCGAGCGCGCCCCCGACCTGGTGATCCTCGACT
GGATGCTGCCGAAGGTCTCAGGCATCGAGGTCTGCCGCCGCCTGCGCGGCCGCTCCGAAACCCGCAACGTGCCGATCATC
ATGCTGACGGCGCGCGGCGAGGAGAGCGACCGGATCCGCGGCCTCGACACCGGGGCTGACGACTATGTGGTCAAGCCGTT
CTCGATGATCGAGCTGACCGCCCGCGTCCGCGCCGTCCTGCGCCGCATCCGCCCGGGCCTGGCCGACGACCGCATCACGG
TCGGCGACATCGTCATCGACCGCGTCGCCCACCGCGTGAAGCGCCAGGGCAAGGAAGTCCACCTGGGTCCCACCGAGTTT
CGCCTGCTCGACTACCTAATGCAGCACCCGGGCCGGGTGTTCAGCCGCGAACAGCTGCTGGACGCCGTCTGGGGCTCGGA
CGTCTATGTCGAGGCCCGCACCGTGGACGTCCACATTGGCCGGCTGCGCAAGGCGCTGAACGGGGACGTGGACGGGGATC
CGATCCGCACGGTGCGTTCGGCGGGGTATTCGCTGGACCTGGACGCGGCTTAG

Protein sequence :
MTPYVLVVEDEDALATLLHYNLDKEGYVVGVAGDGEEALTMASERAPDLVILDWMLPKVSGIEVCRRLRGRSETRNVPII
MLTARGEESDRIRGLDTGADDYVVKPFSMIELTARVRAVLRRIRPGLADDRITVGDIVIDRVAHRVKRQGKEVHLGPTEF
RLLDYLMQHPGRVFSREQLLDAVWGSDVYVEARTVDVHIGRLRKALNGDVDGDPIRTVRSAGYSLDLDAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-35 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-44 47
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-44 47
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-44 47
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-44 47
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-44 47
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-44 47
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-44 47
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-44 47
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-44 47
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-44 47
Caul_4546 YP_001686164.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-41 46
Caul_4546 YP_001686164.1 two component transcriptional regulator AE000516.2.gene3505. Protein 8e-37 45
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-38 44
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-38 44
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-38 44
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-38 44
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-38 44
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-38 44
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-38 44
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-38 44
Caul_4546 YP_001686164.1 two component transcriptional regulator AE015929.1.gene1106. Protein 2e-35 43
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-37 43
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 6e-37 42
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 9e-37 42
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 6e-37 42
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_012469.1.7686381. Protein 9e-41 42
Caul_4546 YP_001686164.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 1e-35 42
Caul_4546 YP_001686164.1 two component transcriptional regulator BAC0125 Protein 3e-34 42
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_002516.2.879194.p Protein 4e-32 42
Caul_4546 YP_001686164.1 two component transcriptional regulator CP004022.1.gene3215. Protein 1e-30 41
Caul_4546 YP_001686164.1 two component transcriptional regulator CP001485.1.gene721.p Protein 6e-33 41
Caul_4546 YP_001686164.1 two component transcriptional regulator BAC0039 Protein 1e-35 41
Caul_4546 YP_001686164.1 two component transcriptional regulator CP001138.1.gene2239. Protein 1e-34 41
Caul_4546 YP_001686164.1 two component transcriptional regulator CP000034.1.gene2186. Protein 1e-35 41
Caul_4546 YP_001686164.1 two component transcriptional regulator NC_002695.1.916589.p Protein 8e-36 41
Caul_4546 YP_001686164.1 two component transcriptional regulator BAC0596 Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Caul_4546 YP_001686164.1 two component transcriptional regulator VFG1390 Protein 2e-40 43
Caul_4546 YP_001686164.1 two component transcriptional regulator VFG1702 Protein 2e-35 42
Caul_4546 YP_001686164.1 two component transcriptional regulator VFG1563 Protein 2e-34 41
Caul_4546 YP_001686164.1 two component transcriptional regulator VFG1386 Protein 2e-31 41
Caul_4546 YP_001686164.1 two component transcriptional regulator VFG1389 Protein 2e-32 41