Gene Information

Name : Caul_3896 (Caul_3896)
Accession : YP_001685519.1
Strain : Caulobacter sp. K31
Genome accession: NC_010338
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4217743 - 4218423 bp
Length : 681 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: ccr:CC_2766 DNA-binding response regulator

DNA sequence : 
ATGCGTATCCTGCTTGTCGAAGACGATCCCGATCTGTCGCGTCAGCTGAAGCTGGCCCTGGGCGACGCGGGCTACGCCGT
CGACCACGCGCCGGACGGCGAGGAGGCCCAGTTCCTGGGCGAGAACGAGCCCTACGACGCCGTCGTGCTCGACCTGGGCC
TGCCCAAGGTCGACGGGGTGTCGGTGCTGGAACGCTGGCGGCGCGGCAACATCGCCACGCCGGTGCTGATCCTCACCGCC
CGGGGCTCGTGGAACGAGAAGGTCGCCGGCTTCGACGCCGGGGCCGACGACTACCTGACCAAGCCCTTCCACACCGAGGA
ACTGCTGGCTCGCCTGCGCGCCCTGCTGCGTCGCTCGGCCGGCCACGCCTCGCCCAGCCTGTCGTGCGGCGGCCTGCGCC
TGGACCCGCGCGCCGCCCGGGCCAGCGTCAACGGCGAGCCCCTGCGGCTGACGTCTCTGGAATACCGCCTGCTGCACTAC
ATGATGATGCACCAGGGCCGGGTGATCGGCCGCACCGAGCTGGTCGAGCACCTGTACGACCAGGACTTCGACCGCGATTC
CAACACCATCGAGGTGTTCATCGGCCGCCTGCGCAAGAAGCTGGGCGCCGAACGGATCGAAACCGTGCGCGGCCTGGGCT
ATCGCCTGACGCCGCTGGAAGGCGAGACGACGGAAGGCTGA

Protein sequence : 
MRILLVEDDPDLSRQLKLALGDAGYAVDHAPDGEEAQFLGENEPYDAVVLDLGLPKVDGVSVLERWRRGNIATPVLILTA
RGSWNEKVAGFDAGADDYLTKPFHTEELLARLRALLRRSAGHASPSLSCGGLRLDPRAARASVNGEPLRLTSLEYRLLHY
MMMHQGRVIGRTELVEHLYDQDFDRDSNTIEVFIGRLRKKLGAERIETVRGLGYRLTPLEGETTEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 2e-28 46
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Caul_3896 YP_001685519.1 two component transcriptional regulator CP000647.1.gene1136. Protein 1e-37 47
Caul_3896 YP_001685519.1 two component transcriptional regulator NC_002516.2.879194.p Protein 7e-38 47
Caul_3896 YP_001685519.1 two component transcriptional regulator BAC0530 Protein 1e-37 47
Caul_3896 YP_001685519.1 two component transcriptional regulator CP004022.1.gene1005. Protein 3e-40 46
Caul_3896 YP_001685519.1 two component transcriptional regulator CP000034.1.gene2022. Protein 1e-37 46
Caul_3896 YP_001685519.1 two component transcriptional regulator NC_002695.1.913289.p Protein 3e-37 46
Caul_3896 YP_001685519.1 two component transcriptional regulator CP001918.1.gene2526. Protein 7e-37 45
Caul_3896 YP_001685519.1 two component transcriptional regulator CP001138.1.gene1939. Protein 7e-38 45
Caul_3896 YP_001685519.1 two component transcriptional regulator BAC0487 Protein 1e-29 44
Caul_3896 YP_001685519.1 two component transcriptional regulator BAC0347 Protein 8e-23 41
Caul_3896 YP_001685519.1 two component transcriptional regulator BAC0197 Protein 3e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Caul_3896 YP_001685519.1 two component transcriptional regulator VFG0473 Protein 1e-30 45
Caul_3896 YP_001685519.1 two component transcriptional regulator VFG0475 Protein 7e-38 45
Caul_3896 YP_001685519.1 two component transcriptional regulator VFG1390 Protein 4e-24 42
Caul_3896 YP_001685519.1 two component transcriptional regulator VFG0596 Protein 2e-25 41
Caul_3896 YP_001685519.1 two component transcriptional regulator VFG1389 Protein 3e-24 41