
|
Name : Caul_2300 (Caul_2300) Accession : YP_001683925.1 Strain : Caulobacter sp. K31 Genome accession: NC_010338 Putative virulence/resistance : Resistance Product : MerR family transcriptional regulator Function : - COG functional category : K : Transcription COG ID : COG0789 EC number : - Position : 2500627 - 2501031 bp Length : 405 bp Strand : - Note : PFAM: regulatory protein MerR; Transcription regulator MerR DNA binding; KEGG: sal:Sala_2443 transcriptional regulator, MerR family DNA sequence : ATGACCCTATCGATCGGCCAACTGGCCAAGGCCTCGGACGTCAAGGTCCCGACCATCCGATTCTACGAAGAGATCGGTCT GCTGCCGGAACCGATCCGGACCGCCAACGACCGGCGCGTCTATGACGCCGCCGCCGTCCGCCGTCTGGCCTTCATTCGCC ACGCCCGGCAGTTGGGCTTCTCGGTCGAAGCGATCCGCAATCTGCTGGATCTTTCGGACAATCCCGATCGCCATTGCGGC GCGGCCAACCGCCTGGCGGCGCAACAGCTTCAAGACGTCGAGGCCAAGATCGCGCAGCTGGAGACGCTTCGCGGCGAGCT ACGCCGCATGGTCGATGCGGCTTGCATGGGTCAGGCCGCCGATTGTCGGGTGATCGAAGCCTTAGCGGGGCAAATGAGCG TCTAG Protein sequence : MTLSIGQLAKASDVKVPTIRFYEEIGLLPEPIRTANDRRVYDAAAVRRLAFIRHARQLGFSVEAIRNLLDLSDNPDRHCG AANRLAAQQLQDVEAKIAQLETLRGELRRMVDAACMGQAADCRVIEALAGQMSV |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ACICU_00234 | YP_001844893.1 | transcriptional regulator | Not tested | AbaR20 | Protein | 5e-12 | 43 |
| cadR | ADZ05769.1 | MerR family transcriptional regulator | Not tested | AbaR11 | Protein | 4e-12 | 43 |
| cadR | ACS32041.1 | MerR family transcriptional regulator | Not tested | AbaR5 | Protein | 5e-12 | 43 |
| cadR | ACN81029.1 | MerR family transcriptional regulator | Not tested | AbaR5 | Protein | 5e-12 | 43 |
| pbrR | CAJ77094.1 | Transcriptional regulator | Not tested | AbaR1 | Protein | 3e-12 | 43 |
| cadR | AGK36653.1 | MerR family transcriptional regulator | Not tested | AbaR26 | Protein | 3e-12 | 43 |
| pbrR | CAJ77021.1 | transcription regulator | Not tested | AbaR1 | Protein | 3e-12 | 43 |
| merR | AAN62181.1 | organomercurial resistance regulatory protein MerR | Not tested | PAGI-2(C) | Protein | 2e-15 | 42 |
| unnamed | ABR13397.1 | mercuric resistance operon regulatory protein | Not tested | PAGI-5 | Protein | 7e-18 | 42 |
| merR | ACN81009.1 | MerR activator/repressor of mer operon | Not tested | AbaR5 | Protein | 3e-15 | 42 |
| merR | CAJ77064.1 | Mercury resistance operon regulatory protein | Not tested | AbaR1 | Protein | 2e-15 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Caul_2300 | YP_001683925.1 | MerR family transcriptional regulator | BAC0684 | Protein | 4e-17 | 43 |
| Caul_2300 | YP_001683925.1 | MerR family transcriptional regulator | BAC0058 | Protein | 1e-19 | 43 |
| Caul_2300 | YP_001683925.1 | MerR family transcriptional regulator | BAC0683 | Protein | 4e-17 | 42 |
| Caul_2300 | YP_001683925.1 | MerR family transcriptional regulator | BAC0462 | Protein | 7e-20 | 42 |
| Caul_2300 | YP_001683925.1 | MerR family transcriptional regulator | BAC0688 | Protein | 2e-16 | 41 |
| Caul_2300 | YP_001683925.1 | MerR family transcriptional regulator | BAC0686 | Protein | 5e-17 | 41 |
| Caul_2300 | YP_001683925.1 | MerR family transcriptional regulator | BAC0689 | Protein | 1e-14 | 41 |