Gene Information

Name : HM1_1535 (HM1_1535)
Accession : YP_001680118.1
Strain : Heliobacterium modesticaldum Ice1
Genome accession: NC_010337
Putative virulence/resistance : Resistance
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1543961 - 1544632 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
TTGCGCATCTTGTTGGCCGAAGATGACCAGCGGCTGGGCAAGTTGATCGACCACATGCTGAGAAGGGAAGGCCATGATGT
CGACTGGGTGCAGCGCGGCGACGACGCCTATCATTATGCCAAAGCATCCCATTACGACTTGCTCGTTCTCGACTGGATGA
TGCCGGCCATGGACGGCGTGATCCTTTGCCGCCAATTGAGGCAAGAGGGGTTGCAATGCCCCATCCTCATGCTGACGGCC
AAGGACGCTGTTGAGGATCGCGTCCAGGGTCTGGACGCCGGCGCCGACGACTACCTGGTCAAACCCTTCGCCTCTGCCGA
GTTGATGGCCCGGCTGCGGGCGCTCTCCCGCCGCGGAAAAATCCCTTTGCAGGAAGAGATCGTCCAGGTTGCCGACCTGC
TATTAAACCGCAACCGCCACTCGGTGACGCGCGGCGGCAAGGAGATCACCCTCACCAGTCGAGAGTTTGCCTTGCTCGAT
CTGCTCGTGCAGAACAAGGGACAGGTGCTTCCCCGCGAGCTGATCATGGAGCGGGTCTGGGGGCTCGACGCCGATGTGAC
CGACAACACCCTGGACGCCTACATCCGATTGCTGCGCAAAAAAATCGAACCCCCCGGCGCCGCTAAGTTGATTCACAACA
TTCGGGGCGTCGGCTACACACTGGAGGAATAG

Protein sequence :
MRILLAEDDQRLGKLIDHMLRREGHDVDWVQRGDDAYHYAKASHYDLLVLDWMMPAMDGVILCRQLRQEGLQCPILMLTA
KDAVEDRVQGLDAGADDYLVKPFASAELMARLRALSRRGKIPLQEEIVQVADLLLNRNRHSVTRGGKEITLTSREFALLD
LLVQNKGQVLPRELIMERVWGLDADVTDNTLDAYIRLLRKKIEPPGAAKLIHNIRGVGYTLEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-35 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-35 44
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HM1_1535 YP_001680118.1 transcriptional regulator BAC0083 Protein 4e-44 48
HM1_1535 YP_001680118.1 transcriptional regulator BAC0111 Protein 3e-44 46
HM1_1535 YP_001680118.1 transcriptional regulator BAC0347 Protein 2e-39 45
HM1_1535 YP_001680118.1 transcriptional regulator BAC0308 Protein 5e-42 45
HM1_1535 YP_001680118.1 transcriptional regulator BAC0197 Protein 4e-39 45
HM1_1535 YP_001680118.1 transcriptional regulator BAC0638 Protein 1e-36 45
HM1_1535 YP_001680118.1 transcriptional regulator NC_003923.1003417.p0 Protein 1e-42 43
HM1_1535 YP_001680118.1 transcriptional regulator NC_013450.8614146.p0 Protein 1e-42 43
HM1_1535 YP_001680118.1 transcriptional regulator NC_002951.3238224.p0 Protein 1e-42 43
HM1_1535 YP_001680118.1 transcriptional regulator NC_007793.3914065.p0 Protein 1e-42 43
HM1_1535 YP_001680118.1 transcriptional regulator NC_002758.1121390.p0 Protein 1e-42 43
HM1_1535 YP_001680118.1 transcriptional regulator NC_010079.5776364.p0 Protein 1e-42 43
HM1_1535 YP_001680118.1 transcriptional regulator NC_002952.2859858.p0 Protein 1e-42 43
HM1_1535 YP_001680118.1 transcriptional regulator NC_007622.3794948.p0 Protein 1e-42 43
HM1_1535 YP_001680118.1 transcriptional regulator BAC0125 Protein 4e-37 43
HM1_1535 YP_001680118.1 transcriptional regulator AF310956.2.orf0.gene Protein 1e-31 41
HM1_1535 YP_001680118.1 transcriptional regulator BAC0288 Protein 4e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HM1_1535 YP_001680118.1 transcriptional regulator VFG1390 Protein 1e-42 47
HM1_1535 YP_001680118.1 transcriptional regulator VFG0596 Protein 2e-35 44
HM1_1535 YP_001680118.1 transcriptional regulator VFG0473 Protein 1e-27 42