
|
Name : Fphi_1931 (Fphi_1931) Accession : YP_001678565.1 Strain : Francisella philomiragia ATCC 25017 Genome accession: NC_010336 Putative virulence/resistance : Virulence Product : phage transcriptional regulator, AlpA Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 1969075 - 1969275 bp Length : 201 bp Strand : - Note : KEGG: spc:Sputcn32_3522 phage transcriptional regulator, AlpA DNA sequence : ATGAAAAAAATAATAAGACTAAAAACTGTGATAGAGATGACAGGACTATCAAGATCAACAATCTATGATTATATGGCTAG AGGATTATTTCCTAGACAAATTACTTTAGGAGAAAACTCTAGAGGTTGGCTATATTCTGAAGTGGATGAGTGGCTAGAAA CTCGTATTCAAAAAAGAGATCAAGAGGAATGTCATGAGTAG Protein sequence : MKKIIRLKTVIEMTGLSRSTIYDYMARGLFPRQITLGENSRGWLYSEVDEWLETRIQKRDQEECHE |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 6e-08 | 50 |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-08 | 50 |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-08 | 50 |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-08 | 50 |
| unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 5e-09 | 48 |
| unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 4e-09 | 48 |
| VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 4e-11 | 44 |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 1e-09 | 43 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-09 | 43 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-09 | 43 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Fphi_1931 | YP_001678565.1 | phage transcriptional regulator, AlpA | VFG1118 | Protein | 9e-09 | 50 |
| Fphi_1931 | YP_001678565.1 | phage transcriptional regulator, AlpA | VFG1141 | Protein | 6e-10 | 43 |