Gene Information

Name : Teth39_0825 (Teth39_0825)
Accession : YP_001664818.1
Strain : Thermoanaerobacter pseudethanolicus ATCC 33223
Genome accession: NC_010321
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 875779 - 876483 bp
Length : 705 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGGCCCATACGGTTTTGGTTATAGAAGATGAAATTCATATATTGGAACTTTTAAGATACAACTTGGAAGCAGCAGGGTA
CAAAGTTATTACTTCGGAAAATGGAAAAGAAGGCTTGGATAAAGCATTTGAAGGAAAACCCGATTTGGTTATATTAGATT
TGATGTTGCCAGATGTAGATGGACTGGAAATATGTAAAATTTTAAAAAAGAATGATGAAACGAAAAATATACCGATAATA
ATGTTAACAGCAAAAAGCGAAGAATTTGATAAAGTATTGGGATTGGAGTTGGGAGCAGATGATTATATAACAAAGCCTTT
CAGCGTAAGAGAATTGTTAGCTCGAATTAAAGCTGTTCTTCGGCGAACCCAACAACCAGAAGAAGAAAAAGAAGAAATAA
TAAAATTTGGTGATATAGTTATAGATACTGGGAAGCATTTGGTTTATAAAAAAGGAAAAGTCCTAGAATTGACTTTAAAA
GAGTTTGAGCTTTTAAAACTTTTGTCTCAAAATATGGGTAAAGTATTAACTAGAGACTATCTTTTAGACAAAGTATGGGG
ATATGAATATGCTGGAGAAACTCGAACTGTTGATGTACACATCAGGCATTTAAGAAAGAAAATAGAAGACGATGATAAAT
CCCCTGTATATATTGAAACTGTAAGAGGAATTGGGTATAAGTTAAATGATAAAGGTGAAGCGTAA

Protein sequence :
MAHTVLVIEDEIHILELLRYNLEAAGYKVITSENGKEGLDKAFEGKPDLVILDLMLPDVDGLEICKILKKNDETKNIPII
MLTAKSEEFDKVLGLELGADDYITKPFSVRELLARIKAVLRRTQQPEEEKEEIIKFGDIVIDTGKHLVYKKGKVLELTLK
EFELLKLLSQNMGKVLTRDYLLDKVWGYEYAGETRTVDVHIRHLRKKIEDDDKSPVYIETVRGIGYKLNDKGEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-32 43
EF0571 NP_814337.1 DNA-binding response regulator Not tested Not named Protein 1e-33 42
ef0091 AAM75294.1 EF0091 Not tested Not named Protein 9e-34 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-31 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-50 55
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-50 55
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-50 55
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-50 55
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-50 55
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-50 55
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-50 55
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-50 55
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-50 55
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-50 55
Teth39_0825 YP_001664818.1 two component transcriptional regulator HE999704.1.gene2815. Protein 9e-48 54
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-44 50
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_012469.1.7686381. Protein 1e-44 49
Teth39_0825 YP_001664818.1 two component transcriptional regulator AE016830.1.gene1681. Protein 5e-45 49
Teth39_0825 YP_001664818.1 two component transcriptional regulator AE015929.1.gene1106. Protein 5e-30 46
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-34 46
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-34 46
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-34 46
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-34 46
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-34 46
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-34 46
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-34 46
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-34 46
Teth39_0825 YP_001664818.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-32 45
Teth39_0825 YP_001664818.1 two component transcriptional regulator BAC0125 Protein 4e-26 43
Teth39_0825 YP_001664818.1 two component transcriptional regulator CP001485.1.gene721.p Protein 2e-28 43
Teth39_0825 YP_001664818.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-35 43
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-32 42
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-32 42
Teth39_0825 YP_001664818.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 1e-31 42
Teth39_0825 YP_001664818.1 two component transcriptional regulator CP000034.1.gene3671. Protein 6e-34 42
Teth39_0825 YP_001664818.1 two component transcriptional regulator BAC0308 Protein 4e-27 41
Teth39_0825 YP_001664818.1 two component transcriptional regulator BAC0111 Protein 9e-28 41
Teth39_0825 YP_001664818.1 two component transcriptional regulator CP001138.1.gene2239. Protein 5e-28 41
Teth39_0825 YP_001664818.1 two component transcriptional regulator CP000034.1.gene2186. Protein 5e-30 41
Teth39_0825 YP_001664818.1 two component transcriptional regulator NC_002695.1.916589.p Protein 3e-30 41
Teth39_0825 YP_001664818.1 two component transcriptional regulator BAC0596 Protein 5e-28 41
Teth39_0825 YP_001664818.1 two component transcriptional regulator BAC0039 Protein 5e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Teth39_0825 YP_001664818.1 two component transcriptional regulator VFG1702 Protein 3e-32 43
Teth39_0825 YP_001664818.1 two component transcriptional regulator VFG1563 Protein 1e-31 42
Teth39_0825 YP_001664818.1 two component transcriptional regulator VFG0596 Protein 3e-26 41