Gene Information

Name : Teth39_1796 (Teth39_1796)
Accession : YP_001665769.1
Strain : Thermoanaerobacter pseudethanolicus ATCC 33223
Genome accession: NC_010321
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1838520 - 1839197 bp
Length : 678 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGGAAAAATTGTTAATTATAGATGATGAAGAGATGTTTGTAAAAGGGTTAAAACTTTCTTTAGAAGAAGAAGGATTTGA
AGTTGACGCCGCTTACGATGGAGAAGAAGGGCTTGACAAAGTTCGTTTAGGGAATTATGACCTTGTAATTTTAGATATTA
TGCTTCCTAAGTTAGACGGTTTTTCGGTATGTAGAGAGATAAGGACTTTTTCAAATATTCCCATAATTATGCTTACTGCA
AGAGGAGACGATATTGACAAGATTGTAGGGATAGAAATAGGAGCTGATGATTATTTAGCGAAGCCCTTTAATACTAGAGA
GCTTACTGCGCGAATAAGAGCACTTTTAAGAAGAGCTACAAATCCTTATACTAAGCGGAAAGATGAAATAAGAAGGGGAG
AACTTTATATAAATATTCCCGAAAGAGCAGTTTACAAGAGAGGGAAGAGAATTGAGCTTACAAATAAAGAATTTGAAATT
TTAGTGTTGTTAGCTTCTAATCCAGGAAAAGTCTATACGAAAGATAAATTGTTAGACTTGATATGGGGATTTGATTTTTA
CGGTGATACAAATACTGTTACAGTGCATGTGAGAAAACTTAGGGAGAAAATTGAAGATGACCCTGCAAATCCTCAATATA
TTTTCACCAAATGGGGTGCAGGATACTATATGAAGTAA

Protein sequence :
MEKLLIIDDEEMFVKGLKLSLEEEGFEVDAAYDGEEGLDKVRLGNYDLVILDIMLPKLDGFSVCREIRTFSNIPIIMLTA
RGDDIDKIVGIEIGADDYLAKPFNTRELTARIRALLRRATNPYTKRKDEIRRGELYINIPERAVYKRGKRIELTNKEFEI
LVLLASNPGKVYTKDKLLDLIWGFDFYGDTNTVTVHVRKLREKIEDDPANPQYIFTKWGAGYYMK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-29 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Teth39_1796 YP_001665769.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-36 47
Teth39_1796 YP_001665769.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-41 46
Teth39_1796 YP_001665769.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-41 46
Teth39_1796 YP_001665769.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-41 46
Teth39_1796 YP_001665769.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-41 46
Teth39_1796 YP_001665769.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-41 46
Teth39_1796 YP_001665769.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-41 46
Teth39_1796 YP_001665769.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-41 46
Teth39_1796 YP_001665769.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-41 46
Teth39_1796 YP_001665769.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-41 46
Teth39_1796 YP_001665769.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-41 46
Teth39_1796 YP_001665769.1 two component transcriptional regulator NC_012469.1.7685629. Protein 3e-43 44
Teth39_1796 YP_001665769.1 two component transcriptional regulator CP000675.2.gene1535. Protein 1e-31 44
Teth39_1796 YP_001665769.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 9e-37 44
Teth39_1796 YP_001665769.1 two component transcriptional regulator NC_012469.1.7686381. Protein 7e-34 43
Teth39_1796 YP_001665769.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-38 43
Teth39_1796 YP_001665769.1 two component transcriptional regulator BAC0083 Protein 4e-28 43
Teth39_1796 YP_001665769.1 two component transcriptional regulator AM180355.1.gene1830. Protein 3e-30 42
Teth39_1796 YP_001665769.1 two component transcriptional regulator CP000034.1.gene3671. Protein 4e-32 42
Teth39_1796 YP_001665769.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-31 41
Teth39_1796 YP_001665769.1 two component transcriptional regulator BAC0308 Protein 2e-29 41
Teth39_1796 YP_001665769.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-34 41
Teth39_1796 YP_001665769.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Teth39_1796 YP_001665769.1 two component transcriptional regulator VFG0596 Protein 5e-30 42
Teth39_1796 YP_001665769.1 two component transcriptional regulator VFG1389 Protein 1e-28 41