Gene Information

Name : BcerKBAB4_5259 (BcerKBAB4_5259)
Accession : YP_001648030.1
Strain : Bacillus weihenstephanensis KBAB4
Genome accession: NC_010184
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5240861 - 5241568 bp
Length : 708 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bcy:Bcer98_4006 two component transcriptional regulator, winged helix family

DNA sequence :
ATGATGGGAAAGAAAATTTTAGTAGTTGATGATGAAAAACCAATTGCGGATATTTTGAAGTTCAACCTAGAAAAAGAAGG
TTTTGAAATTGTAATGGCGCATGATGGTGATGAGGCGATTGAAAAAGCAAATGAAGAACAGCCAGATATGGTTTTATTAG
ATATTATGTTACCGGGAAAAGACGGTTTAGAGGTATGTCGTGAAATACGTAAAAGCTCAGAAATGCCAATTATTATGCTT
ACAGCAAAAGACTCTGAAATTGATAAAGTATTAGGGCTTGAGCTTGGGGCAGATGATTATGTAACGAAGCCATTTAGTAC
GAGGGAGTTACTTGCTCGTGTGAAAGCGAATTTACGTCGCCATCAGCAGGGTGGTGCTGCAGAGAAAGAAGAAAATACCG
AAATGGTTATTGGACCAATCGTTATCAATTCGAACGCTTATAGTGTAACAAAGCGTGAAGAAAGCATTGAGCTTACACAT
CGTGAATTTGAATTACTACATTATTTAGCGAAGCATTTAGGTCAAGTTATGACTCGTGAACATTTATTACAAACAGTTTG
GGGTTATGATTATTTTGGAGATGTACGTACAGTAGACGTAACAGTACGTCGTTTACGCGAAAAAATTGAAGATAATCCAA
GTCATCCTACTTTAATTGTAACTAGACGTGGGGTAGGGTATTACTTGCGTGACCCAGAACAGGAATAG

Protein sequence :
MMGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEEQPDMVLLDIMLPGKDGLEVCREIRKSSEMPIIML
TAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLRRHQQGGAAEKEENTEMVIGPIVINSNAYSVTKREESIELTH
REFELLHYLAKHLGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPTLIVTRRGVGYYLRDPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-37 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_012469.1.7685629. Protein 7e-64 66
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-56 56
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 8e-57 55
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-57 55
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 8e-57 55
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 8e-57 55
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 8e-57 55
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 7e-57 55
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 8e-57 55
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 8e-57 55
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 8e-57 55
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_012469.1.7686381. Protein 6e-45 50
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-47 50
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator AE016830.1.gene1681. Protein 6e-49 48
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator CP004022.1.gene3215. Protein 3e-35 47
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator AE000516.2.gene3505. Protein 4e-39 46
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator HE999704.1.gene1528. Protein 4e-32 45
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-38 44
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-39 44
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator CP000647.1.gene4257. Protein 2e-32 44
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator BAC0533 Protein 2e-32 44
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_002695.1.915041.p Protein 2e-33 44
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator CP001138.1.gene4273. Protein 2e-32 44
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator CP000034.1.gene3834. Protein 2e-33 44
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-34 43
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator AM180355.1.gene1830. Protein 1e-37 43
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-37 43
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-37 43
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-37 43
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-37 43
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-37 43
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-37 43
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-37 43
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-37 43
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator BAC0125 Protein 1e-31 42
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 1e-36 42
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-32 42
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-32 42
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 7e-32 42
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator CP004022.1.gene1676. Protein 5e-32 42
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 6e-35 41
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 4e-39 41
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 4e-39 41
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator AE015929.1.gene1106. Protein 3e-32 41
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator BAC0039 Protein 4e-34 41
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator CP000034.1.gene2186. Protein 4e-34 41
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator NC_002695.1.916589.p Protein 4e-34 41
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator CP001918.1.gene3444. Protein 4e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator VFG1563 Protein 3e-37 43
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator VFG1702 Protein 6e-37 43
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator VFG1390 Protein 5e-38 42
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator VFG1386 Protein 2e-35 42
BcerKBAB4_5259 YP_001648030.1 two component transcriptional regulator VFG1389 Protein 7e-31 42