Gene Information

Name : BcerKBAB4_4419 (BcerKBAB4_4419)
Accession : YP_001647206.1
Strain : Bacillus weihenstephanensis KBAB4
Genome accession: NC_010184
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4422812 - 4423531 bp
Length : 720 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bca:BCE_4720 DNA-binding response regulator PhoP

DNA sequence :
ATGAACAATCGTATTTTAGTAGTTGATGATGAGGAATTTATCTTAACTTTAATTGAATTTAATTTACAACAAGCTGGGTT
TGAAGTTATTACAGCAATGGATGGAGAAATGGCGCTTCAAAAAGCGACTACAGAACGCCCAGATTTAATTATATTAGATT
TAATGCTTCCAAAAATGGATGGTATGGAAGTTTGTAAAGAATTACGATTGCAGCGTATTATGACGCCGATTTTAATGTTA
ACAGCAAAAGATGATGAATTTGATAAGGTGCTAGGTCTTGAGCTTGGGGCTGATGATTATATGACGAAGCCATTTAGTCC
AAGGGAAGTTGTTGCTCGTGTGAAGGCGATTTTGCGCCGTACGAAATTACAGCAGGAAGAACAAGTTTCAGAATCGCCAG
ATGAAGAGAGCATCAAAATTGCAGAGCTTAAAATTTTACCGGAGTTTTATGAAGCGTACTTCCAAGGAAGGAAACTGGAA
TTAACACCGAAAGAATTTGAGTTACTTGTTTATCTTGCGAAAAATAAAAGTCGTGTATTAACTCGTGACCAATTATTAAG
TGCTGTATGGAATTATGATTTTGCCGGTGATACAAGAATTGTTGATGTCCATATTAGCCATTTGCGCGATAAAATTGAAC
AAAATACGAAAAAACCGACGTACATTAAAACGATACGTGGTTTAGGTTATAAATTAGAGGAGCCAAAAGTGGATGAATAA

Protein sequence :
MNNRILVVDDEEFILTLIEFNLQQAGFEVITAMDGEMALQKATTERPDLIILDLMLPKMDGMEVCKELRLQRIMTPILML
TAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILRRTKLQQEEQVSESPDEESIKIAELKILPEFYEAYFQGRKLE
LTPKEFELLVYLAKNKSRVLTRDQLLSAVWNYDFAGDTRIVDVHISHLRDKIEQNTKKPTYIKTIRGLGYKLEEPKVDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-34 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 7e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-72 65
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-74 64
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-74 64
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-74 64
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-74 64
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-74 64
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-74 64
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-74 64
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-74 64
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-74 63
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-74 63
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-62 56
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-63 55
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_012469.1.7685629. Protein 5e-54 52
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator BAC0197 Protein 3e-29 44
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-40 44
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-39 43
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator CP001485.1.gene721.p Protein 9e-36 43
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator BAC0533 Protein 3e-34 43
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator CP004022.1.gene3215. Protein 1e-36 43
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator CP000647.1.gene4257. Protein 3e-34 43
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator CP001918.1.gene5135. Protein 2e-31 43
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 4e-39 42
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 4e-39 42
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator AM180355.1.gene1830. Protein 2e-39 42
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-38 42
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator CP000034.1.gene2186. Protein 3e-36 42
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_002695.1.915041.p Protein 2e-33 42
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator CP001918.1.gene3444. Protein 9e-36 42
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator BAC0596 Protein 8e-36 42
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_002695.1.916589.p Protein 3e-36 42
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator BAC0039 Protein 3e-36 42
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator CP000034.1.gene3834. Protein 2e-33 42
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator CP001138.1.gene4273. Protein 9e-34 42
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator CP001138.1.gene2239. Protein 8e-36 42
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator AF310956.2.orf0.gene Protein 5e-35 41
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator AE016830.1.gene2255. Protein 3e-34 41
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator U35369.1.gene1.p01 Protein 3e-34 41
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 9e-39 41
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 9e-39 41
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 9e-39 41
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 9e-39 41
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 9e-39 41
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 9e-39 41
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 9e-39 41
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 9e-39 41
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 6e-36 41
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-31 41
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator CP004022.1.gene1676. Protein 3e-32 41
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator CP000647.1.gene2531. Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator VFG1386 Protein 8e-41 44
BcerKBAB4_4419 YP_001647206.1 two component transcriptional regulator VFG1389 Protein 3e-35 44