Gene Information

Name : BcerKBAB4_0381 (BcerKBAB4_0381)
Accession : YP_001643275.1
Strain : Bacillus weihenstephanensis KBAB4
Genome accession: NC_010184
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 439175 - 439753 bp
Length : 579 bp
Strand : +
Note : PFAM: stress protein; KEGG: btl:BALH_0401 tellurium resistance protein, TerD family

DNA sequence : 
ATGGTTATTCAATTGCAAAAAGGACAGAAAATAGATTTAGCTAAAACAAGCCCAGGTTTATCAAGAGCAGTAATTGGTCT
TGGATGGGATATTAAATCTTATGATGGTGGATCTGATTTCGATTTAGATGCATCTGCCTTTTTATTAGATGCGAACGGGA
AATGTACGAAGGAAACTGATTTTATTTTCTATAATAATTTACAGTCTCCTTGTGAATCAGTTTTACATACAGGAGATAAC
CGTACAGGTGCAGGTGACGGTGATGATGAGCAACTTGTTGTCGATTTGAAAAAGGTTCCAGCAGATGTTCATAAAATTGC
TATTACAGTTACAATTTATGATGGAGAAGGCCGTAATCAAAACTTTGGACAGGTTGCAAATGCATTCGTGCGTTTAGCAA
ATGAAGAAACAAACGAAGAAGTTCTTCGTTTTGATTTAGGGGAAGATTTCTCCATTGAAACAGCAGTTGTCTTTTGTGAA
TTATATCGTCATAATGGACAGTGGAAGTTTAGTGCAGTAGGAAGTGGATTCCAAGGTGGATTAGGTGCGCTTGTAAGAGC
GTATGGCTTGGATGCATAA

Protein sequence : 
MVIQLQKGQKIDLAKTSPGLSRAVIGLGWDIKSYDGGSDFDLDASAFLLDANGKCTKETDFIFYNNLQSPCESVLHTGDN
RTGAGDGDDEQLVVDLKKVPADVHKIAITVTIYDGEGRNQNFGQVANAFVRLANEETNEEVLRFDLGEDFSIETAVVFCE
LYRHNGQWKFSAVGSGFQGGLGALVRAYGLDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-47 62
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-43 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-43 57
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-43 56
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-41 53
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-41 53
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-42 53
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-39 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BcerKBAB4_0381 YP_001643275.1 stress protein BAC0389 Protein 9e-44 58
BcerKBAB4_0381 YP_001643275.1 stress protein BAC0390 Protein 7e-43 53