Gene Information

Name : BcerKBAB4_0266 (BcerKBAB4_0266)
Accession : YP_001643160.1
Strain : Bacillus weihenstephanensis KBAB4
Genome accession: NC_010184
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 298511 - 299224 bp
Length : 714 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bcz:BCZK0258 response regulator

DNA sequence :
ATGAAAGATATACGTATTCTTATAGCAGATGACGATAAAGAAATTCGAGACTTATTAAAAAGATATTTAGAACGAGAATT
ATATATGGTAGATACTGCAATTAATGGAGAAGAAGCTTTGTGCTTATTTAACCAAAATAACTACAACCTCGTTATATTAG
ATCTTATGATGCCGAAAGTAGATGGTATCGAAGTGTGTAGAAAACTTAGAGATACAACCAACATCCCTATATTAATGCTA
ACTGCTAAAGATCACGAAGTTGATAAAATTTTGGGCTTAAGCATAGGTGCTGATGATTATATTACGAAACCTTTCAGTAT
TCACGAAGTGGTTGCAAGAGTAAAAGCTCTTATGCGACGTTTTTTAGTTCTTGGAAGTAACACTAACGTACAAGAGAAAA
CAGCTTTAACATTTAAAGGACTAACTATCGATTTTAAAAAATACACAGTCCATACGAACGGAAAAGAAATCAACTTAACT
GGAAAAGAACTTGAACTATTAAAATTCTTCGCTTCAAACCCAGAGCAAGTATTTACGAAAACACAACTCTTTCGGAATGT
ATGGGACGATAATTATACAGAAGATGATAATACAGTTATGGTGCATATTAGAAAGCTTAGAAAGAAAATAGAAATTGATT
CTTCCAATCCAAAATTCATTCAGACTGTATGGGGAATCGGTTATAAGTTTGTAGGTGAAAAGGTTGAAAAATGA

Protein sequence :
MKDIRILIADDDKEIRDLLKRYLERELYMVDTAINGEEALCLFNQNNYNLVILDLMMPKVDGIEVCRKLRDTTNIPILML
TAKDHEVDKILGLSIGADDYITKPFSIHEVVARVKALMRRFLVLGSNTNVQEKTALTFKGLTIDFKKYTVHTNGKEINLT
GKELELLKFFASNPEQVFTKTQLFRNVWDDNYTEDDNTVMVHIRKLRKKIEIDSSNPKFIQTVWGIGYKFVGEKVEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-41 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-40 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-52 52
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 5e-48 47
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator AM180355.1.gene1830. Protein 2e-44 45
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-41 45
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 6e-43 44
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 6e-43 44
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 1e-40 44
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 4e-44 44
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-41 44
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 1e-41 43
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-40 42
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-41 41
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-40 41
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-40 41
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-40 41
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-40 41
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-40 41
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-40 41
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-40 41
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-40 41
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-40 41
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator CP004022.1.gene1676. Protein 8e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator VFG1563 Protein 6e-42 41
BcerKBAB4_0266 YP_001643160.1 two component transcriptional regulator VFG1702 Protein 5e-41 41