Gene Information

Name : BcerKBAB4_2944 (BcerKBAB4_2944)
Accession : YP_001645758.1
Strain : Bacillus weihenstephanensis KBAB4
Genome accession: NC_010184
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2992240 - 2992914 bp
Length : 675 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bce:BC3200 two-component response regulator

DNA sequence :
ATGCGAGTTCTTATTGTCGAAGATGAAAAAGACTTACAAAATATATTGGTAAAACGATTAAATGCAGAATATTATAGTGT
CGATGGATGTGGGAATGGAGAAGATGCTTTGGATTATATAAGCATGGCTACCTACGATTTGATTGTGCTTGACATTATGA
TTCCCGGAATAGATGGTTTACAAGTATTACAAAGATTACGTGCGGACAATAATACAACTCCTGTCTTGCTTCTTACAGCT
AAAGATACAATTGATGATCGCGTAACAGGACTCGACTTAGGTGCGGACGATTATTTAGTAAAGCCCTTTGCTTTTGATGA
GCTGTTAGCAAGAATTCGAGTGTTGATGCGAAGAAAAACAGGAAATACATCTAATGTGTTTGAAATCGCTGACCTAGTGG
TGGATTGCAATATGCATAAAGTAACAAGAGGAGATCAAGTTATCAATCTTTCCAGTAAAGAATTTGCTATTTTAGAATAT
ATGATTCGTAATAAAGAAGTTGTGTTGACACGAGATAAAATTGAGCAACATGTGTGGAATTACGACTATGAAGGTGGCTC
GAATATTATTGATGTTTACGTCCGCTATCTTCGCAAAAAAATTGATAGCCAGTTTGAAACGAAGTTAATTCATACAGTAC
GAGGAACTGGTTACGTATTGCGAGTAGAATCATGA

Protein sequence :
MRVLIVEDEKDLQNILVKRLNAEYYSVDGCGNGEDALDYISMATYDLIVLDIMIPGIDGLQVLQRLRADNNTTPVLLLTA
KDTIDDRVTGLDLGADDYLVKPFAFDELLARIRVLMRRKTGNTSNVFEIADLVVDCNMHKVTRGDQVINLSSKEFAILEY
MIRNKEVVLTRDKIEQHVWNYDYEGGSNIIDVYVRYLRKKIDSQFETKLIHTVRGTGYVLRVES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-40 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator BAC0111 Protein 2e-51 49
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator BAC0308 Protein 6e-48 49
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator BAC0125 Protein 4e-47 48
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator BAC0197 Protein 4e-48 48
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator BAC0638 Protein 4e-46 48
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator BAC0347 Protein 5e-44 47
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator BAC0083 Protein 3e-49 46
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-40 44
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-40 44
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-40 44
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-40 44
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-40 44
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-40 44
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-40 44
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-40 44
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator AE015929.1.gene1106. Protein 5e-36 41
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-35 41
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator BAC0487 Protein 1e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator VFG1390 Protein 5e-49 46
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator VFG1386 Protein 5e-46 43
BcerKBAB4_2944 YP_001645758.1 two component transcriptional regulator VFG0596 Protein 6e-41 41