Gene Information

Name : BcerKBAB4_2424 (BcerKBAB4_2424)
Accession : YP_001645263.1
Strain : Bacillus weihenstephanensis KBAB4
Genome accession: NC_010184
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2504235 - 2504900 bp
Length : 666 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bca:BCE_2749 transcription response regulator-like protein

DNA sequence :
ATGAAAAACTATCATATTCTCGTGGTAGAAGACGATCAAGAAATTCAGGAATTAATTAAACAATTTTTAATGACACAACA
GTATACAGTGGTAGTCGCATCAGATGGATTAGAGGGTATGACACAATTTAATAAGCAATCCTTTGATTTAATTCTTCTAG
ATGTAATGATGCCCAATCTTAATGGATTTGAAGTATCCAAGATGATTCGAAGTCAGTCAAACGTACCAATTATTATGCTA
ACTGCATTGGAAGAAGAGGAAGATCAAATGAAAGGGTTCGATCTTGGAATCGATGATTATATAACAAAACCCTTTTCGTT
TCATGTTTTGATTAGACGAGTCGAAGCTGTACTTAGAAGAAGTTATGATAAAAATGTAAATAATCATTTGGTATTTAAAG
AAGTGCGTATCGATGTTGATGCATATAGAGTATATGTAAATGACGTTGAAATTTTATTAACGATAAAAGAGTTTGAAATT
CTACAACTACTATTTCAAAATGAGAGAAAAGTACTCACAAGAGAAAATATCGTAGAAAAAGTTTGGGGGTACGATTATTT
TGGAGAAACACGAATAATTGATACACACATTAAAAACCTACGTAAAAAATTAGCTATTCCTTACATTAAAACAATAAAGG
GTATTGGTTATAAAATTGATGAGTAG

Protein sequence :
MKNYHILVVEDDQEIQELIKQFLMTQQYTVVVASDGLEGMTQFNKQSFDLILLDVMMPNLNGFEVSKMIRSQSNVPIIML
TALEEEEDQMKGFDLGIDDYITKPFSFHVLIRRVEAVLRRSYDKNVNNHLVFKEVRIDVDAYRVYVNDVEILLTIKEFEI
LQLLFQNERKVLTRENIVEKVWGYDYFGETRIIDTHIKNLRKKLAIPYIKTIKGIGYKIDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 2e-55 63
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-39 43
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 7e-41 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator HE999704.1.gene1202. Protein 3e-46 46
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-36 44
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-36 44
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-36 44
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-36 44
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 7e-36 44
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-36 44
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-36 44
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-36 44
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-36 44
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-36 44
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator AF310956.2.orf0.gene Protein 6e-40 43
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator AE016830.1.gene2255. Protein 3e-41 43
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator U35369.1.gene1.p01 Protein 3e-41 43
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-34 43
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator AE015929.1.gene1106. Protein 5e-28 42
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-31 42
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 4e-33 42
BcerKBAB4_2424 YP_001645263.1 two component transcriptional regulator HE999704.1.gene2815. Protein 5e-33 41