Gene Information

Name : Bpet4611 (Bpet4611)
Accession : YP_001633229.1
Strain : Bordetella petrii DSM 12804
Genome accession: NC_010170
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4872274 - 4872834 bp
Length : 561 bp
Strand : +
Note : -

DNA sequence :
ATGCAGTACGACTTGATTATTTTGGACATTAATCTCCCCGACATGGAAGGATTTGAGGTCCTGCAACGAATCCGGCAAAG
TGATGCTGTCCCAGTCATGATGCTAACCGCACGAACGAGCTTGGAAGATCGAGTCAGGGGCTTAGAACAAGGTGCAGACG
ATTACCTCGCGAAACCATTTGCTCTTTCTGAATTGCAGGCAAGGGTTCAGGCTCTTCGCCGCCGTGGAAGCGGCAACGAG
AGCAGACGGGGACCGAACGTGCTTCGCGTCGCAGATTTGGAACTTGATTTACTGAGGCGCCGCGTCGTGCGTGGCAACGC
ACGCATCGACTTGACCGCCAAGGAATTCAATTTGCTGACGATTCTTATGCGCCGTCAAGGCGAAGTTGTCTCACGCTTGG
TATTGGCCGAGCACGTATGGGATATGAACTTCAATAGCAATACAAACGTCGTGGAAGTAGCGGTCCGTCGACTGCGCTCT
AAGATTGATGACCCATTCGATGCGAAGTTGCTGCACACGATTCGTGGAATGGGCTATTTGATCGAGTACCGGCCCGATTG
A

Protein sequence :
MQYDLIILDINLPDMEGFEVLQRIRQSDAVPVMMLTARTSLEDRVRGLEQGADDYLAKPFALSELQARVQALRRRGSGNE
SRRGPNVLRVADLELDLLRRRVVRGNARIDLTAKEFNLLTILMRRQGEVVSRLVLAEHVWDMNFNSNTNVVEVAVRRLRS
KIDDPFDAKLLHTIRGMGYLIEYRPD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-34 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-33 46
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-21 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpet4611 YP_001633229.1 two-component response regulator BAC0083 Protein 3e-42 61
Bpet4611 YP_001633229.1 two-component response regulator BAC0638 Protein 3e-33 60
Bpet4611 YP_001633229.1 two-component response regulator BAC0197 Protein 1e-38 57
Bpet4611 YP_001633229.1 two-component response regulator BAC0125 Protein 2e-38 55
Bpet4611 YP_001633229.1 two-component response regulator BAC0111 Protein 2e-37 52
Bpet4611 YP_001633229.1 two-component response regulator BAC0308 Protein 9e-36 50
Bpet4611 YP_001633229.1 two-component response regulator BAC0347 Protein 2e-30 48
Bpet4611 YP_001633229.1 two-component response regulator HE999704.1.gene1528. Protein 3e-23 44
Bpet4611 YP_001633229.1 two-component response regulator NC_012469.1.7685629. Protein 1e-23 42
Bpet4611 YP_001633229.1 two-component response regulator AE000516.2.gene3505. Protein 8e-20 42
Bpet4611 YP_001633229.1 two-component response regulator AF162694.1.orf4.gene Protein 4e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpet4611 YP_001633229.1 two-component response regulator VFG0596 Protein 7e-35 48
Bpet4611 YP_001633229.1 two-component response regulator VFG1389 Protein 2e-26 44
Bpet4611 YP_001633229.1 two-component response regulator VFG1390 Protein 5e-23 43
Bpet4611 YP_001633229.1 two-component response regulator VFG1702 Protein 8e-22 41
Bpet4611 YP_001633229.1 two-component response regulator VFG1386 Protein 2e-23 41