Name : Bpet2882 (Bpet2882) Accession : YP_001631492.1 Strain : Bordetella petrii DSM 12804 Genome accession: NC_010170 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 3030078 - 3030281 bp Length : 204 bp Strand : + Note : - DNA sequence : ATGGAACACCTTCCGCAAATACTCCGCATCACAGACGTAACACGCATCACAGGTCTATCCCGGCCGGCGATTTATTACAA CGTCAAACGCGGCCTTTTCCCCCGGCAAATCCAATTAGGCCCGCGTTCGGTCGGCTGGCTCGCGTCCGATGTCGAAGCCT GGTTTCAATCCCGCATCAGCGCTCGCGACGCGCAATCGGCATAA Protein sequence : MEHLPQILRITDVTRITGLSRPAIYYNVKRGLFPRQIQLGPRSVGWLASDVEAWFQSRISARDAQSA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 4e-10 | 46 |
unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 5e-10 | 46 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-05 | 46 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-05 | 46 |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 4e-05 | 46 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 1e-05 | 46 |
PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 4e-08 | 44 |
VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 6e-10 | 42 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 2e-04 | 42 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
Bpet2882 | YP_001631492.1 | hypothetical protein | VFG0651 | Protein | 6e-06 | 46 |