Gene Information

Name : Bpet2882 (Bpet2882)
Accession : YP_001631492.1
Strain : Bordetella petrii DSM 12804
Genome accession: NC_010170
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 3030078 - 3030281 bp
Length : 204 bp
Strand : +
Note : -

DNA sequence :
ATGGAACACCTTCCGCAAATACTCCGCATCACAGACGTAACACGCATCACAGGTCTATCCCGGCCGGCGATTTATTACAA
CGTCAAACGCGGCCTTTTCCCCCGGCAAATCCAATTAGGCCCGCGTTCGGTCGGCTGGCTCGCGTCCGATGTCGAAGCCT
GGTTTCAATCCCGCATCAGCGCTCGCGACGCGCAATCGGCATAA

Protein sequence :
MEHLPQILRITDVTRITGLSRPAIYYNVKRGLFPRQIQLGPRSVGWLASDVEAWFQSRISARDAQSA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAA21398.1 - Not tested HPI Protein 5e-10 46
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 4e-10 46
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 2e-05 46
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 4e-05 46
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 1e-05 46
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 2e-05 46
PMI2608 YP_002152324.1 prophage regulatory protein Not tested Not named Protein 4e-08 44
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 6e-10 42
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 2e-04 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpet2882 YP_001631492.1 hypothetical protein VFG0651 Protein 6e-06 46