Gene Information

Name : Bpet2466 (Bpet2466)
Accession : YP_001631076.1
Strain : Bordetella petrii DSM 12804
Genome accession: NC_010170
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2590140 - 2590856 bp
Length : 717 bp
Strand : -
Note : -

DNA sequence :
ATGTCCAAGCGCATCCTGATAGTCGAAGACGACGTCCACATCGCAGACCTGCTGCAATTGCACCTGCGCGACGAAGGCTA
TGAGGTCACCCACGCGGCCGAAGGGGAAACCGGCCTGCGCCAGCTTGAAGCCGGACGCTGGGACGCGCTGGTGCTGGACC
TGATGCTGCCCGGCATCGACGGCCTGGAGATCTGCAAGCGCGCCCGGGCCATGGCGCGGTATACGCCCATCATCATCACC
AGCGCCCGCTCCAGCGAGGTGCACCGCATCCTGGGGCTGGAGCTGGGCGCCGACGACTACCTGGCCAAGCCGTTCTCGAT
GCTGGAACTGGTGGCCCGCATCAAGGCGCTGCTGCGCCGGACCGACGCGCTCGAACGCAATGCCCGCCTGGATGCCGGGC
GGCTAGAGGTTTCGGGCCTTTCCATCGACCCCGTGACGCGCGATGCCACGGTCGACGGCCAGCCGCTGGACCTGACGCCG
CGTGAATTCGACCTGTTGTATTTCTTCGCCCGCCATCCTGGCAAAGTGTTCTCGCGCATGGATTTGCTGAACCAGGTGTG
GGGCTACCAGCACGAAGGCTACGAGCACACGGTGAACACCCACATCAACCGGCTGCGCACCAAAATCGAAGCCGATCCTT
CCGAGCCCAGCCGCATCCTGACGGTATGGGGCCGCGGCTACAAGTTTGCCGCGCCGGCCTCCGGAGAGCCCACATGA

Protein sequence :
MSKRILIVEDDVHIADLLQLHLRDEGYEVTHAAEGETGLRQLEAGRWDALVLDLMLPGIDGLEICKRARAMARYTPIIIT
SARSSEVHRILGLELGADDYLAKPFSMLELVARIKALLRRTDALERNARLDAGRLEVSGLSIDPVTRDATVDGQPLDLTP
REFDLLYFFARHPGKVFSRMDLLNQVWGYQHEGYEHTVNTHINRLRTKIEADPSEPSRILTVWGRGYKFAAPASGEPT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-71 60
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-71 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpet2466 YP_001631076.1 two-component response regulator NC_012469.1.7685629. Protein 2e-44 47
Bpet2466 YP_001631076.1 two-component response regulator HE999704.1.gene2815. Protein 5e-43 45
Bpet2466 YP_001631076.1 two-component response regulator AE000516.2.gene3505. Protein 4e-40 44
Bpet2466 YP_001631076.1 two-component response regulator NC_012469.1.7686381. Protein 2e-43 43
Bpet2466 YP_001631076.1 two-component response regulator CP001918.1.gene5135. Protein 4e-29 43
Bpet2466 YP_001631076.1 two-component response regulator AE015929.1.gene1106. Protein 2e-33 42
Bpet2466 YP_001631076.1 two-component response regulator FJ349556.1.orf0.gene Protein 8e-40 42
Bpet2466 YP_001631076.1 two-component response regulator AF155139.2.orf0.gene Protein 1e-42 42
Bpet2466 YP_001631076.1 two-component response regulator HE999704.1.gene1528. Protein 5e-34 42
Bpet2466 YP_001631076.1 two-component response regulator NC_007622.3794948.p0 Protein 4e-37 41
Bpet2466 YP_001631076.1 two-component response regulator NC_003923.1003417.p0 Protein 4e-37 41
Bpet2466 YP_001631076.1 two-component response regulator NC_013450.8614146.p0 Protein 4e-37 41
Bpet2466 YP_001631076.1 two-component response regulator NC_002951.3238224.p0 Protein 4e-37 41
Bpet2466 YP_001631076.1 two-component response regulator NC_007793.3914065.p0 Protein 4e-37 41
Bpet2466 YP_001631076.1 two-component response regulator NC_002758.1121390.p0 Protein 4e-37 41
Bpet2466 YP_001631076.1 two-component response regulator NC_010079.5776364.p0 Protein 4e-37 41
Bpet2466 YP_001631076.1 two-component response regulator NC_002952.2859858.p0 Protein 4e-37 41
Bpet2466 YP_001631076.1 two-component response regulator CP000034.1.gene3834. Protein 4e-32 41
Bpet2466 YP_001631076.1 two-component response regulator CP000647.1.gene4257. Protein 4e-32 41
Bpet2466 YP_001631076.1 two-component response regulator CP001138.1.gene4273. Protein 4e-32 41
Bpet2466 YP_001631076.1 two-component response regulator NC_002695.1.915041.p Protein 4e-32 41
Bpet2466 YP_001631076.1 two-component response regulator BAC0533 Protein 4e-32 41
Bpet2466 YP_001631076.1 two-component response regulator AE016830.1.gene1681. Protein 3e-44 41
Bpet2466 YP_001631076.1 two-component response regulator NC_002952.2859905.p0 Protein 4e-44 41
Bpet2466 YP_001631076.1 two-component response regulator NC_007622.3794472.p0 Protein 4e-44 41
Bpet2466 YP_001631076.1 two-component response regulator NC_002951.3237708.p0 Protein 3e-44 41
Bpet2466 YP_001631076.1 two-component response regulator NC_002758.1121668.p0 Protein 3e-44 41
Bpet2466 YP_001631076.1 two-component response regulator NC_009641.5332272.p0 Protein 3e-44 41
Bpet2466 YP_001631076.1 two-component response regulator NC_013450.8614421.p0 Protein 3e-44 41
Bpet2466 YP_001631076.1 two-component response regulator NC_007793.3914279.p0 Protein 3e-44 41
Bpet2466 YP_001631076.1 two-component response regulator NC_003923.1003749.p0 Protein 3e-44 41
Bpet2466 YP_001631076.1 two-component response regulator NC_002745.1124361.p0 Protein 3e-44 41
Bpet2466 YP_001631076.1 two-component response regulator NC_009782.5559369.p0 Protein 3e-44 41
Bpet2466 YP_001631076.1 two-component response regulator CP004022.1.gene3215. Protein 5e-36 41
Bpet2466 YP_001631076.1 two-component response regulator CP000034.1.gene2186. Protein 4e-32 41
Bpet2466 YP_001631076.1 two-component response regulator CP001138.1.gene2239. Protein 7e-32 41
Bpet2466 YP_001631076.1 two-component response regulator NC_002695.1.916589.p Protein 5e-32 41
Bpet2466 YP_001631076.1 two-component response regulator BAC0039 Protein 4e-32 41
Bpet2466 YP_001631076.1 two-component response regulator CP001918.1.gene3444. Protein 1e-31 41
Bpet2466 YP_001631076.1 two-component response regulator BAC0596 Protein 7e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpet2466 YP_001631076.1 two-component response regulator VFG1563 Protein 3e-71 60
Bpet2466 YP_001631076.1 two-component response regulator VFG1702 Protein 2e-71 60
Bpet2466 YP_001631076.1 two-component response regulator VFG1389 Protein 1e-32 44