Gene Information

Name : Bpet1571 (Bpet1571)
Accession : YP_001630179.1
Strain : Bordetella petrii DSM 12804
Genome accession: NC_010170
Putative virulence/resistance : Resistance
Product : mebrane transport protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 1622565 - 1622894 bp
Length : 330 bp
Strand : -
Note : -

DNA sequence : 
ATGAAGTGGCTGTACCTGGGTATTGCCATCGTGGCCGAGATCATCGCCACCAGCGCCCTGAAAAGCGCCGAGGGCTTCAC
CCGGCTGCTGCCTTCGCTGGTCACGGTGGCCGGCTACGCCGTGGCTTTCTATTTCCTGGCGCTGACGCTGCGCGAGATTC
CGGTGGGCATCGCCTACGCCATCTGGTCCGGGGTGGGCATCGTGCTGATCTCGCTGGTGGGCGCGCTGTTCTTCAAGCAG
CACCTCGACGGCCCCGCCCTGCTGGGCATCGCGCTGATTCTCGCGGGCGTGGTCATCATGAACGTGTTTTCGAAATCGGT
GGGCCACTGA

Protein sequence : 
MKWLYLGIAIVAEIIATSALKSAEGFTRLLPSLVTVAGYAVAFYFLALTLREIPVGIAYAIWSGVGIVLISLVGALFFKQ
HLDGPALLGIALILAGVVIMNVFSKSVGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-20 61
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-20 61
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-20 61
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-20 61
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-20 61
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-20 61
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-20 61
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-20 61
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-20 61
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-20 61
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-20 61
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-20 61
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-20 61
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-20 61
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-20 61
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-20 61
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-20 61
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-20 61
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-20 61
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-20 61
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-20 61
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-20 61
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-20 61
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-20 61
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-20 61
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-20 61
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-20 61
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-20 61
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-20 61
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-20 61
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 9e-13 45
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 1e-12 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpet1571 YP_001630179.1 mebrane transport protein BAC0002 Protein 6e-23 66
Bpet1571 YP_001630179.1 mebrane transport protein NC_010410.6003348.p0 Protein 6e-23 66
Bpet1571 YP_001630179.1 mebrane transport protein BAC0322 Protein 5e-21 61
Bpet1571 YP_001630179.1 mebrane transport protein BAC0323 Protein 6e-21 61
Bpet1571 YP_001630179.1 mebrane transport protein BAC0324 Protein 9e-22 60
Bpet1571 YP_001630179.1 mebrane transport protein BAC0150 Protein 2e-16 59
Bpet1571 YP_001630179.1 mebrane transport protein CP001138.1.gene1489. Protein 7e-21 59
Bpet1571 YP_001630179.1 mebrane transport protein NC_002695.1.913273.p Protein 2e-16 58
Bpet1571 YP_001630179.1 mebrane transport protein BAC0377 Protein 3e-18 54
Bpet1571 YP_001630179.1 mebrane transport protein CP004022.1.gene1549. Protein 3e-16 50
Bpet1571 YP_001630179.1 mebrane transport protein BAC0327 Protein 5e-17 47
Bpet1571 YP_001630179.1 mebrane transport protein BAC0249 Protein 2e-11 47
Bpet1571 YP_001630179.1 mebrane transport protein BAC0329 Protein 9e-18 47
Bpet1571 YP_001630179.1 mebrane transport protein AE000516.2.gene3301. Protein 2e-11 47
Bpet1571 YP_001630179.1 mebrane transport protein BAC0325 Protein 2e-16 46
Bpet1571 YP_001630179.1 mebrane transport protein BAC0139 Protein 2e-15 45
Bpet1571 YP_001630179.1 mebrane transport protein BAC0321 Protein 2e-17 43
Bpet1571 YP_001630179.1 mebrane transport protein BAC0326 Protein 5e-17 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpet1571 YP_001630179.1 mebrane transport protein VFG1587 Protein 4e-13 45
Bpet1571 YP_001630179.1 mebrane transport protein VFG1586 Protein 5e-13 42