Gene Information

Name : Bpet1143 (Bpet1143)
Accession : YP_001629747.1
Strain : Bordetella petrii DSM 12804
Genome accession: NC_010170
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 1204380 - 1204724 bp
Length : 345 bp
Strand : +
Note : -

DNA sequence :
ATGATCGGTCTGCCCGCGGGCACCCGCGTGTGGCTGGCGGCTGGCACCACCGACATGCGCCGCGGCTTCGATGGGCTGGC
CTCCATCGTGCAGCACACGCTGCTGGAGGATCCCTTCAGTGGCCATGTGTTCGTGTTCCGGGGCCGCCGGGGCGATCGCA
TCAAGGTGTTGTGGTGGAGCGGGGACGGCCTGTGCCTGCTGGCCAAGCGCCTGGAGCACGGTCACTTCGTGTGGCCAGCG
GCCGAGTCGGGTGCCGTGCACCTGACCACAGCACAGCTCTCGATGCTGCTCGAAGGCATCGACTGGCGCCGCCCCGCCAG
GACCACTAGGCCGACACAGACATAA

Protein sequence :
MIGLPAGTRVWLAAGTTDMRRGFDGLASIVQHTLLEDPFSGHVFVFRGRRGDRIKVLWWSGDGLCLLAKRLEHGHFVWPA
AESGAVHLTTAQLSMLLEGIDWRRPARTTRPTQT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 4e-34 72
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-34 72
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 8e-34 71
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 6e-31 71
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-31 69
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-31 69
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-32 68
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-32 68
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 6e-32 67
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 9e-32 67
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 9e-32 67
unnamed AAC31493.1 L0014 Not tested LEE Protein 6e-32 67
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 9e-32 67
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 6e-32 67
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 9e-32 67
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 4e-31 67
unnamed AAL99258.1 unknown Not tested LEE Protein 6e-32 67
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 4e-31 67
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 4e-26 65
unnamed AAL08461.1 unknown Not tested SRL Protein 1e-31 65
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 6e-32 63
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 6e-32 63
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 9e-32 60
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 6e-31 60
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 6e-31 60

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpet1143 YP_001629747.1 hypothetical protein VFG1665 Protein 3e-34 71
Bpet1143 YP_001629747.1 hypothetical protein VFG1698 Protein 1e-32 68
Bpet1143 YP_001629747.1 hypothetical protein VFG0792 Protein 2e-32 67
Bpet1143 YP_001629747.1 hypothetical protein VFG1709 Protein 2e-32 67
Bpet1143 YP_001629747.1 hypothetical protein VFG1517 Protein 2e-26 65
Bpet1143 YP_001629747.1 hypothetical protein VFG1052 Protein 5e-32 65
Bpet1143 YP_001629747.1 hypothetical protein VFG1737 Protein 3e-32 60