Gene Information

Name : RSal33209_0951 (RSal33209_0951)
Accession : YP_001624106.1
Strain : Renibacterium salmoninarum ATCC 33209
Genome accession: NC_010168
Putative virulence/resistance : Unknown
Product : IS994
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 806509 - 806874 bp
Length : 366 bp
Strand : -
Note : OrfA

DNA sequence :
ATGGCAGGGAAAACTACGACACGGTATCCGCAGGAGTTGAAGGATCGTACGGTGCGCATGGTGGCGGAGATGGAGGGTGC
ATCTTCGGAGTGGGCGGCGATGCAAAAAGTTGCCCAGCTTTTGGGTGTGGGTGTGCCGGAAACGGTGCGTAAATGGGTCC
GGCAAGCCGAGATCGATGTTGGTACTAGAACTGGAACAACGAGCACGGAATCGGCCGAGCTGAAACGGTTACGGCGTGAG
AACGCTGAGCTGAAACGGGCGAACGCGATCCTTCGGAGTGCTTCAGCTTTTTTCGCGGTCGAACTCGACCGCCACAACAC
TGATCGTGAAATACATCAAGGACCATGCCGGTCACCGCGAGAATAA

Protein sequence :
MAGKTTTRYPQELKDRTVRMVAEMEGASSEWAAMQKVAQLLGVGVPETVRKWVRQAEIDVGTRTGTTSTESAELKRLRRE
NAELKRANAILRSASAFFAVELDRHNTDREIHQGPCRSPRE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 4e-12 50
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 5e-14 50
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 5e-14 50
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 5e-14 50
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 5e-14 50
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 4e-12 50
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 4e-12 50
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 4e-11 50
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 1e-13 49
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 1e-13 49
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 2e-13 49
unnamed AAF09023.1 unknown Not tested SHI-O Protein 1e-11 49
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 1e-11 49
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 1e-13 49
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 1e-13 49
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 5e-10 49
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 7e-10 49
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 6e-10 48
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 1e-10 48
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 2e-11 48
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-11 48
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-11 48
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-11 48
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 3e-11 48
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 3e-11 48
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-09 47
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 5e-09 47
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 3e-09 47
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 5e-09 47
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 3e-09 47

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RSal33209_0951 YP_001624106.1 IS994 VFG1603 Protein 1e-11 50
RSal33209_0951 YP_001624106.1 IS994 VFG0606 Protein 3e-11 48
RSal33209_0951 YP_001624106.1 IS994 VFG0643 Protein 9e-12 48
RSal33209_0951 YP_001624106.1 IS994 VFG1717 Protein 1e-09 47