Gene Information

Name : RSal33209_0675 (RSal33209_0675)
Accession : YP_001623836.1
Strain : Renibacterium salmoninarum ATCC 33209
Genome accession: NC_010168
Putative virulence/resistance : Unknown
Product : IS994
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 563064 - 563414 bp
Length : 351 bp
Strand : -
Note : OrfA

DNA sequence :
ATGGCAGGGAAAACTACGACACGGTATCCGCAGGAGTTGAAGGATCGTGCGGAGATGGAGGGTGCGTCTTCGGAGTGGGC
GGCGATGCAAAAAGTTGCCCAGCTTTTGGGTGTGGGTGTGCCGGAAACGGTGCGTAAATGGGTCCGGCAAGCCGAGATCG
ATGTTGGTACTAGAACTGGAACAACGAGCACGGAATCGGCCGAGCTGAAACGGTTACGGCGTGAGAACGCTGAGCTGAAA
CGGGCGAACGCGATCCTTCGGAGTGCTTCAGCTTTTTTCGCGGTCGAACTCGACCGCCACAACACTGATCGTGAAATACA
TCAAGGACCATGCCGGTCACCGCGAGAATAA

Protein sequence :
MAGKTTTRYPQELKDRAEMEGASSEWAAMQKVAQLLGVGVPETVRKWVRQAEIDVGTRTGTTSTESAELKRLRRENAELK
RANAILRSASAFFAVELDRHNTDREIHQGPCRSPRE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 4e-10 48
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 4e-10 48
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 4e-10 48
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 4e-10 48
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 8e-09 47
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 8e-09 47
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 8e-09 47
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 3e-07 47
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 3e-10 46
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 3e-10 46
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 9e-08 46
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-07 46
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 9e-08 46
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-07 46
unnamed AAF09023.1 unknown Not tested SHI-O Protein 7e-08 46
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 1e-07 46
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 7e-08 46
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 4e-10 46
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 1e-07 46
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 3e-10 46
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 3e-10 46
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 4e-06 46
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 5e-06 46
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 4e-06 45
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 8e-07 45
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-05 43
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-05 43
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 7e-06 43
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 1e-05 43
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 7e-06 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RSal33209_0675 YP_001623836.1 IS994 VFG1603 Protein 1e-07 47
RSal33209_0675 YP_001623836.1 IS994 VFG0643 Protein 4e-08 46
RSal33209_0675 YP_001623836.1 IS994 VFG0606 Protein 2e-07 45
RSal33209_0675 YP_001623836.1 IS994 VFG1717 Protein 3e-06 43