Gene Information

Name : sce0456 (sce0456)
Accession : YP_001611093.1
Strain : Sorangium cellulosum So ce 56
Genome accession: NC_010162
Putative virulence/resistance : Unknown
Product : integrase/recombinase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG4974
EC number : -
Position : 651516 - 652466 bp
Length : 951 bp
Strand : -
Note : High confidence in function and specificity

DNA sequence : 
ATGACCCTCATCGAAGCCGTACGCGCCACCATACGACGCCTGCATTACTCTCCGCGTACCGAAGAGGCGTATGTCCACTG
GATCCGGCAATTCATCCGCTTCCATCACGGCAAGCACCCACGGCAGATGGGCGCGGAAGAGGTCACGGCCTTCCTCAACG
ATCTTGCGGTCGCGCGCCGCACCGCGGCGTCCACGCAGAACCAAGCGCTGTGCGCGCTCCTCTTCCTTTACAGACGGGTC
CTCGACCTGCAGATACCCCGGCTCGAAGCGCTCGAGCGTGCCCGCCGGCCGGAGCACCTCCCCACGGTCCTCTCGCGACA
GGACGCGCTCACCTTGCTCGAGCACCTGATCCCACCTTTTCGACTCATCGGCGAGCTCCTCTACGGAAGCGGCCTCCGCC
TCCTCGAAGCGCTTTCGATTCGCGTCAAAGACGTCGACCTCGATCGACGGCAAATCATGGTGCGCCGCGGGAAAGGACAG
CACGACCGGCCGGCCTTGCTCCCCGCTCGGGCGCGCGACGAGCTGCAGGCCCAGCTCGACGCCGTGGCGCAACGGCACAA
GAAGGAGCTCGCGGTTGGCCGCGGCGAGGTCGACCTGCCCCACGCGCTGCGAGCGAAGATGCCAGGAGCAGCCACGAGCC
TCGCCTGGCAGTACATCTTCCCCGCCTCTCGCCCTTGCACCGATCCTGCGACGGGTCGACAGGTCCTCTACCACCTGCAC
GAATCGGCGGTGCAAAGGGCCGTGCACGATGCCGGACGGGCGGCGGGGCTCACCAAGCGCGCGACATGCCACATCCTCCG
CCACAGCTTCGCGACCCACCTGCTCGAGGCGGGCACCGACATCCGGACGATCCAAACATTGCTCGGCCACAAGGATGTAC
GGACCACGATGATCTACACCCACATCGTCGACCGCGGTCCTCTCGGCGTGATCAGTCCTCTCGACCGCTGA

Protein sequence : 
MTLIEAVRATIRRLHYSPRTEEAYVHWIRQFIRFHHGKHPRQMGAEEVTAFLNDLAVARRTAASTQNQALCALLFLYRRV
LDLQIPRLEALERARRPEHLPTVLSRQDALTLLEHLIPPFRLIGELLYGSGLRLLEALSIRVKDVDLDRRQIMVRRGKGQ
HDRPALLPARARDELQAQLDAVAQRHKKELAVGRGEVDLPHALRAKMPGAATSLAWQYIFPASRPCTDPATGRQVLYHLH
ESAVQRAVHDAGRAAGLTKRATCHILRHSFATHLLEAGTDIRTIQTLLGHKDVRTTMIYTHIVDRGPLGVISPLDR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
EC042_4092 YP_006098375.1 integrase Not tested Tn2411 Protein 5e-61 48
unnamed ACF06155.1 class 1 integrase Not tested Tn5036-like Protein 4e-61 48
intI1 AGK07098.1 IntI1 integrase Not tested SGI1 Protein 4e-61 48
intI1 AGK06930.1 IntI1 integrase Not tested SGI1 Protein 1e-60 47
intI1 ACY75520.1 integrase Not tested Tn6060 Protein 2e-60 47
intI1 YP_005797145.1 integrase Not tested AbaR4e Protein 2e-60 47
intI1 AGK06967.1 IntI1 integrase Not tested SGI1 Protein 1e-60 47
intI1 ACY75535.1 integrase Not tested Tn6060 Protein 2e-60 47
intI1 ACN81019.1 IntI1 integrase Not tested AbaR5 Protein 2e-60 47
intI1 AGK07013.1 IntI1 integrase Not tested SGI1 Protein 1e-60 47
intI1 AGF34986.1 IntI1 integrase Not tested SGI1 Protein 2e-60 47
intI1 AGK07071.1 IntI1 integrase Not tested SGI1 Protein 1e-60 47
intI1 AGF35026.1 IntI1 integrase Not tested SGI1 Protein 2e-60 47
intI1 AFV53119.1 IntI1 integrase Not tested AbGRI2-1 Protein 1e-60 47
intI1 CAB46685.1 DNA integrase Not tested Not named Protein 2e-60 47
unnamed AAL08437.1 Tn21 integrase IntI1 Not tested SRL Protein 4e-60 47
intI1 AGK36642.1 IntI1 integrase Not tested AbaR26 Protein 1e-60 47
intI1 ABB48427.1 IntI1 integrase Not tested SGI1 Protein 1e-60 47
intI1 AAK02045.1 integrase Not tested SGI1 Protein 2e-60 47
intI CAJ77082.1 Integrase Not tested AbaR1 Protein 1e-60 47
intI1 ABZ01842.1 IntI1 Not tested SGI2 Protein 2e-60 47
intI YP_001844881.1 integrase Not tested AbaR20 Protein 2e-60 47
intI1 AGF35060.1 IntI1 integrase Not tested SGI1 Protein 1e-60 47
intI CAJ77028.1 Integrase Not tested AbaR1 Protein 2e-60 47
intI1 YP_005797130.1 integrase Not tested AbaR4e Protein 2e-60 47
intI1 AFL65913.1 class 1 integrase Not tested SGI1-J6 Protein 6e-42 46
int1 YP_005160012.1 integrase Not tested Not named Protein 3e-46 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
sce0456 YP_001611093.1 integrase/recombinase VFG1028 Protein 2e-60 47