Gene Information

Name : sce2049 (sce2049)
Accession : YP_001612688.1
Strain : Sorangium cellulosum So ce 56
Genome accession: NC_010162
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2779476 - 2780162 bp
Length : 687 bp
Strand : +
Note : Family membership

DNA sequence :
ATGGCGCTGCGGCTCCTGCTCATCGACGACGACACCCGGCTCCACGCCTTGCTCGCGAGCTACCTCGAGCAGAACGGGTT
CGCGGTGACCGTCGCGTGCGACGGCGCGCGCGGCCTCTTGGCGCTCGCCGCGGGCACCTTCGACGCCGTCCTGCTCGACG
TGATGATGCCGGGCATGGACGGCATCGAGGTCGTCCGCCGCATCCGGCAGAAGAGCTCGATGCCGATCCTCATGCTCACC
GCCCGCGGCGACGAGGCCGATCGCGTGGTCGGCCTCGAGATCGGCGCCGACGACTACATCGCGAAGCCCTTCAGCCCGCG
CGAGCTGCTCGCGCGCCTCCGCGCGGTGCTCCGGCGGGCCACGCCCGACGCCGCCGGCGAGCGGATCGTGGCCGGCGACA
TCGCCATCGACGTGCCCGGCCGCGTCGTCACCGTGTCGGGCAAGCCCACCGATCTCACCGGCATCGAGTTCGACATCCTC
GTCGCCCTCGCGCGGCGCGCTGGCCGCGTCGTCGCCCGGGAGGCGCTCCTCGAGGAGGCCGGCCGCGGCGACGTCAACGT
CGGCGGGCGGACGGTCGACGTGCACATCTCGCACCTGCGGCAGAAGCTGTCGGACGACCCGAGGTCGCCGAGGCTCATCA
AGACGGTGCGCGGCGTCGGCTACGTGCTCGCCAAGGACCGCGTGTGA

Protein sequence :
MALRLLLIDDDTRLHALLASYLEQNGFAVTVACDGARGLLALAAGTFDAVLLDVMMPGMDGIEVVRRIRQKSSMPILMLT
ARGDEADRVVGLEIGADDYIAKPFSPRELLARLRAVLRRATPDAAGERIVAGDIAIDVPGRVVTVSGKPTDLTGIEFDIL
VALARRAGRVVAREALLEEAGRGDVNVGGRTVDVHISHLRQKLSDDPRSPRLIKTVRGVGYVLAKDRV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-19 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-18 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
sce2049 YP_001612688.1 two-component system response regulator CP000675.2.gene1535. Protein 3e-31 48
sce2049 YP_001612688.1 two-component system response regulator AE000516.2.gene3505. Protein 8e-25 48
sce2049 YP_001612688.1 two-component system response regulator BAC0125 Protein 3e-23 46
sce2049 YP_001612688.1 two-component system response regulator NC_012469.1.7685629. Protein 4e-20 46
sce2049 YP_001612688.1 two-component system response regulator NC_002952.2859905.p0 Protein 1e-25 45
sce2049 YP_001612688.1 two-component system response regulator NC_002951.3237708.p0 Protein 2e-25 45
sce2049 YP_001612688.1 two-component system response regulator NC_007622.3794472.p0 Protein 1e-25 45
sce2049 YP_001612688.1 two-component system response regulator NC_002758.1121668.p0 Protein 2e-25 45
sce2049 YP_001612688.1 two-component system response regulator NC_003923.1003749.p0 Protein 1e-25 45
sce2049 YP_001612688.1 two-component system response regulator NC_009641.5332272.p0 Protein 2e-25 45
sce2049 YP_001612688.1 two-component system response regulator NC_013450.8614421.p0 Protein 2e-25 45
sce2049 YP_001612688.1 two-component system response regulator NC_007793.3914279.p0 Protein 2e-25 45
sce2049 YP_001612688.1 two-component system response regulator NC_002745.1124361.p0 Protein 2e-25 45
sce2049 YP_001612688.1 two-component system response regulator NC_009782.5559369.p0 Protein 2e-25 45
sce2049 YP_001612688.1 two-component system response regulator AE016830.1.gene1681. Protein 2e-27 45
sce2049 YP_001612688.1 two-component system response regulator CP001138.1.gene4273. Protein 5e-20 44
sce2049 YP_001612688.1 two-component system response regulator CP000034.1.gene3834. Protein 3e-20 44
sce2049 YP_001612688.1 two-component system response regulator CP000647.1.gene4257. Protein 3e-20 44
sce2049 YP_001612688.1 two-component system response regulator NC_002695.1.915041.p Protein 3e-20 44
sce2049 YP_001612688.1 two-component system response regulator BAC0533 Protein 3e-20 44
sce2049 YP_001612688.1 two-component system response regulator CP000034.1.gene3671. Protein 8e-28 43
sce2049 YP_001612688.1 two-component system response regulator BAC0197 Protein 2e-17 43
sce2049 YP_001612688.1 two-component system response regulator CP001918.1.gene5135. Protein 5e-19 43
sce2049 YP_001612688.1 two-component system response regulator FJ349556.1.orf0.gene Protein 2e-26 42
sce2049 YP_001612688.1 two-component system response regulator AF155139.2.orf0.gene Protein 3e-26 42
sce2049 YP_001612688.1 two-component system response regulator HE999704.1.gene2815. Protein 2e-23 42
sce2049 YP_001612688.1 two-component system response regulator CP000034.1.gene2186. Protein 4e-19 42
sce2049 YP_001612688.1 two-component system response regulator NC_002695.1.916589.p Protein 4e-19 42
sce2049 YP_001612688.1 two-component system response regulator BAC0039 Protein 4e-19 42
sce2049 YP_001612688.1 two-component system response regulator CP004022.1.gene3215. Protein 2e-22 41
sce2049 YP_001612688.1 two-component system response regulator NC_012469.1.7686381. Protein 2e-23 41
sce2049 YP_001612688.1 two-component system response regulator CP001918.1.gene3444. Protein 4e-18 41
sce2049 YP_001612688.1 two-component system response regulator BAC0596 Protein 6e-19 41
sce2049 YP_001612688.1 two-component system response regulator CP001138.1.gene2239. Protein 6e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
sce2049 YP_001612688.1 two-component system response regulator VFG1390 Protein 8e-21 45
sce2049 YP_001612688.1 two-component system response regulator VFG1389 Protein 1e-18 44
sce2049 YP_001612688.1 two-component system response regulator VFG0596 Protein 1e-19 43