Gene Information

Name : trwH5 (Btr_2529a)
Accession : YP_001610490.1
Strain : Bartonella tribocorum CIP 105476
Genome accession: NC_010161
Putative virulence/resistance : Virulence
Product : TrwH5 protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2459102 - 2459245 bp
Length : 144 bp
Strand : +
Note : Component of type IV secretion system; hypothetical protein

DNA sequence :
GTGAAGTCGGTCGTTTTTATAATTTTGATTGCAAATCTTTTATCGGCTTGTGCATTAGCACCAAAGCTAAAACAACCTAA
TGATAGAAACCGTGTGCCTATTAATAAAACAATCCCTGCCGAAATTAAGCGAGGAGACAGATGA

Protein sequence :
MKSVVFIILIANLLSACALAPKLKQPNDRNRVPINKTIPAEIKRGDR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
trwH5 YP_001610490.1 TrwH5 protein Virulence Not named Protein 7e-16 100
trwH2 CAD42850.1 TrwH2 protein Not tested trw-PAI Protein 5e-16 100
trwH4 CAD42855.1 TrwH4 protein Not tested trw-PAI Protein 5e-16 100
trwH5 CAD42858.1 TrwH5 protein Not tested trw-PAI Protein 5e-16 100
trwH2 YP_001610482.1 TrwH2 protein Virulence Not named Protein 7e-16 100
trwH4 YP_001610487.1 TrwH4 protein Virulence Not named Protein 7e-16 100

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
trwH5 YP_001610490.1 TrwH5 protein VFG2262 Protein 9e-12 73
trwH5 YP_001610490.1 TrwH5 protein VFG2265 Protein 6e-11 69