Gene Information

Name : trwL1 (Btr_2511)
Accession : YP_001610468.1
Strain : Bartonella tribocorum CIP 105476
Genome accession: NC_010161
Putative virulence/resistance : Virulence
Product : TrwL1 protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2442474 - 2442791 bp
Length : 318 bp
Strand : +
Note : Component of type IV secretion system; hypothetical protein

DNA sequence :
ATGAAAAAATCAAATACCCTTCAAACAATAGTTCATAATAAAACTATTCCAATATCTGCAGCTTTAACTGTATTCTTTAT
GGATAATTTTGCATATGCTAACCCGACAACCTTGATAAATGCAAAGAAGGCTTTAGACGGTTTAAAGGGCGATTTAAAAA
TTATCATCCCTATTGCCGCCGGTGTTATACTTTTATGTCTAGCAATTGCTTATGCAGGGCGCTACATTGAAAAAAGTACG
TTCATACGATGGGCAGTTGGCGTTGTTGTCGCTGGTTCAGCACACGAACTTGCTACACTGTTATTTACTCGATCTTAA

Protein sequence :
MKKSNTLQTIVHNKTIPISAALTVFFMDNFAYANPTTLINAKKALDGLKGDLKIIIPIAAGVILLCLAIAYAGRYIEKST
FIRWAVGVVVAGSAHELATLLFTRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
trwL1 YP_001610468.1 TrwL1 protein Virulence Not named Protein 2e-35 100
trwL1 CAD42836.1 TrwL1 protein Not tested trw-PAI Protein 1e-35 100
trwL4 YP_001610471.1 TrwL4 protein Virulence Not named Protein 4e-31 89
trwL4 CAD42839.1 TrwL4 protein Not tested trw-PAI Protein 3e-31 89
trwL5 CAD42840.1 TrwL5 protein Not tested trw-PAI Protein 1e-29 88
trwL5 YP_001610472.1 TrwL5 protein Virulence Not named Protein 2e-29 88
trwL6 CAD42841.1 TrwL6 protein Not tested trw-PAI Protein 5e-29 87
trwL6 YP_001610473.1 TrwL6 protein Virulence Not named Protein 7e-29 87
trwL2 CAD42837.1 TrwL2 protein Not tested trw-PAI Protein 7e-27 81
trwL2 YP_001610469.1 TrwL2 protein Virulence Not named Protein 1e-26 81
trwL3 CAD42838.1 TrwL3 protein Not tested trw-PAI Protein 7e-28 77
trwL3 YP_001610470.1 TrwL3 protein Virulence Not named Protein 1e-27 77

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
trwL1 YP_001610468.1 TrwL1 protein VFG2250 Protein 8e-19 62
trwL1 YP_001610468.1 TrwL1 protein VFG2253 Protein 6e-22 60
trwL1 YP_001610468.1 TrwL1 protein VFG2252 Protein 4e-15 58
trwL1 YP_001610468.1 TrwL1 protein VFG2254 Protein 1e-19 56
trwL1 YP_001610468.1 TrwL1 protein VFG2256 Protein 1e-21 54
trwL1 YP_001610468.1 TrwL1 protein VFG2251 Protein 1e-19 53
trwL1 YP_001610468.1 TrwL1 protein VFG2255 Protein 3e-19 51