Gene Information

Name : terD (YpAngola_A0666)
Accession : YP_001605248.1
Strain : Yersinia pestis Angola
Genome accession: NC_010159
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 669417 - 669995 bp
Length : 579 bp
Strand : +
Note : identified by match to protein family HMM PF02342

DNA sequence :
ATGGGTGTATCTCTTTCGAAAGGCGGTAATGTCTCCCTGAGTAAAGAAGCTCCAACAATGACGAATGTGCTGATTGGCCT
CGGCTGGGATGCCCGTTCTACAGATGGTCAGGATTTCGACCTGGATGCTTCAGCTTTTCTTTTGACTGCAAACGGCAAAG
TACGTAACGATGCAGATTTCATTTTCTACAACAATCTGAAATCATCTGATGGTTCAGTGATGCACACCGGTGATAACCGT
ACTGGTGAAGGCGAGGGTGACGATGAGTCGCTGAAAATCAAATTGCCTTTGATCCCAGCAGATGTGGATAAGATTGTTTT
CGTTGTCACTATTCATGATGCTCAGGCGCGCCGTCAGAGCTTCGGTCAGGTGGCTAATGCCTTTATTCGCCTGGTAAACG
ATGATAATGGCGTTGAAATTGCGCGTTACGACCTGTCTGAAGATGCGTCCACCGAAACAGCGATGCTGTTTGGTGAGCTG
TATCGCCATAATGCGGAGTGGAAATTCCGTGCGGTAGGTCAGGGCTATGCGGGTGGTTTGTCGTCTGTTTGTGCTCAGTA
TGGCATCAACGCATCTTAA

Protein sequence :
MGVSLSKGGNVSLSKEAPTMTNVLIGLGWDARSTDGQDFDLDASAFLLTANGKVRNDADFIFYNNLKSSDGSVMHTGDNR
TGEGEGDDESLKIKLPLIPADVDKIVFVVTIHDAQARRQSFGQVANAFIRLVNDDNGVEIARYDLSEDASTETAMLFGEL
YRHNAEWKFRAVGQGYAGGLSSVCAQYGINAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-78 87
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-78 87
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-77 86
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-68 72
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-60 68
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-60 68
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-60 68
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-59 67
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-26 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-26 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD YP_001605248.1 tellurium resistance protein BAC0389 Protein 2e-77 87
terD YP_001605248.1 tellurium resistance protein BAC0390 Protein 3e-64 69