Name : YpAngola_A1363 (YpAngola_A1363) Accession : YP_001605891.1 Strain : Yersinia pestis Angola Genome accession: NC_010159 Putative virulence/resistance : Virulence Product : AlpA family transcriptional regulator Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 1422471 - 1422671 bp Length : 201 bp Strand : - Note : identified by match to protein family HMM PF05930 DNA sequence : ATGTCTGATATTAATTTGATCCGCTTACCTGAAGTGATTGAGAAAATACGACTGAAAAAATCATCAATTTATCATTTGAT TAGCCTCAATCAATTCCCTCGCCCAATAAAATTAGGGCCGCGTTCAGTGGCCTGGGTTGAAAGTGAAGTCGATGAATGGG TCATTATCAGAATCAATCAACGCGAGGAGGGTCGCAACTAA Protein sequence : MSDINLIRLPEVIEKIRLKKSSIYHLISLNQFPRPIKLGPRSVAWVESEVDEWVIIRINQREEGRN |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 3e-11 | 50 |
VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-11 | 50 |
VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-11 | 50 |
PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 1e-09 | 49 |
unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 7e-11 | 48 |
unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 1e-10 | 48 |
VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-10 | 45 |
VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 5e-10 | 45 |
VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 5e-10 | 45 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 2e-04 | 41 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 2e-04 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
YpAngola_A1363 | YP_001605891.1 | AlpA family transcriptional regulator | VFG1141 | Protein | 1e-11 | 50 |
YpAngola_A1363 | YP_001605891.1 | AlpA family transcriptional regulator | VFG1118 | Protein | 2e-10 | 45 |