Gene Information

Name : Bmul_4315 (Bmul_4315)
Accession : YP_001584287.1
Strain :
Genome accession: NC_010086
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1361928 - 1362626 bp
Length : 699 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bch:Bcen2424_4290 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence : 
ATGAAAGTACTGATCATCGAAGACGAACCGAAAGTCGTCGAATATCTGAAGAGCGGACTGACCGAGGAAGGCTGGGTCGT
CGATACCGCGCTCGACGGCGAGGACGGTGCATGGAAGGCGGTCGAGTTCGACTACGACGTGGTCGTGCTCGACGTGATGC
TGCCGAAGCTCGACGGCTTCGGCGTGCTGCGCGCCTTGCGCGCGCAGAAGCAGACGCCCGTCATCATGCTGACTGCGCGC
GACCGCGTCGACGATCGCGTGCGCGGGCTGCGCGGCGGCGCCGACGACTATCTGACCAAGCCGTTCTCGTTCCTCGAACT
GATCGAGCGGCTGCGCGCATTGACGCGTCGCGCGCGCGTGCAGGAATCGACGCTGATCTCGATCGGCGACCTGCGTGTCG
ACCTGATCGGCCGCCGCGCGACGCGCGACGGCACGCGGCTCGATCTGACCGCGCAGGAATTCCAGCTGCTCGGCGTGCTC
GCGCGGCGCAGCGGCGAGGTGCTGTCGAAGACGACGATCGCCGAGCTCGTCTGGGACGTGAATTTCGACAGCAACGCGAA
CGTCGTCGAAACCGCGATCAAGCGGCTGCGCGCGAAGCTCGACGGCCCGTTCCCGGAGAAGCTGCTGCATACGATTCGCG
GCATGGGCTACGTGCTCGAAGCGCGCGACGACGGCGGCGACACGGAGAAGCGCACATGA

Protein sequence : 
MKVLIIEDEPKVVEYLKSGLTEEGWVVDTALDGEDGAWKAVEFDYDVVVLDVMLPKLDGFGVLRALRAQKQTPVIMLTAR
DRVDDRVRGLRGGADDYLTKPFSFLELIERLRALTRRARVQESTLISIGDLRVDLIGRRATRDGTRLDLTAQEFQLLGVL
ARRSGEVLSKTTIAELVWDVNFDSNANVVETAIKRLRAKLDGPFPEKLLHTIRGMGYVLEARDDGGDTEKRT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-41 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-40 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bmul_4315 YP_001584287.1 two component heavy metal response transcriptional regulator BAC0083 Protein 4e-48 59
Bmul_4315 YP_001584287.1 two component heavy metal response transcriptional regulator BAC0125 Protein 1e-52 57
Bmul_4315 YP_001584287.1 two component heavy metal response transcriptional regulator BAC0638 Protein 2e-39 55
Bmul_4315 YP_001584287.1 two component heavy metal response transcriptional regulator BAC0197 Protein 7e-47 54
Bmul_4315 YP_001584287.1 two component heavy metal response transcriptional regulator BAC0111 Protein 3e-45 51
Bmul_4315 YP_001584287.1 two component heavy metal response transcriptional regulator BAC0308 Protein 3e-45 50
Bmul_4315 YP_001584287.1 two component heavy metal response transcriptional regulator BAC0347 Protein 3e-40 48
Bmul_4315 YP_001584287.1 two component heavy metal response transcriptional regulator CP000675.2.gene1535. Protein 7e-30 41
Bmul_4315 YP_001584287.1 two component heavy metal response transcriptional regulator CP001918.1.gene5135. Protein 3e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bmul_4315 YP_001584287.1 two component heavy metal response transcriptional regulator VFG0596 Protein 1e-41 53
Bmul_4315 YP_001584287.1 two component heavy metal response transcriptional regulator VFG1389 Protein 6e-31 48
Bmul_4315 YP_001584287.1 two component heavy metal response transcriptional regulator VFG1386 Protein 4e-26 42