Gene Information

Name : Bmul_0680 (Bmul_0680)
Accession : YP_001578872.1
Strain :
Genome accession: NC_010084
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 744727 - 745404 bp
Length : 678 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bur:Bcep18194_A5949 two component transcriptional regulator, winged helix family

DNA sequence : 
ATGGATGCGATTCCGATGCGGATTCTGCTTGTCGAAGACGACCGGATGATTGCCGAAGGCGTGCGCAAGGCGCTGCGCTC
GGACGGCTTCGCGGTCGACTGGGTGCAGGACGGCGAGTCGGCGCTCACGGCGCTCGGCGGCGAGTCCTACGACCTGCTGC
TGCTCGATCTCGGCCTGCCCAAGCGCGACGGCATCGACGTGCTGCGCACGCTGCGCGCGCGCGGGCTGTCGCTGCCGGTG
CTGATCGTCACCGCGCGCGATGCGATCGCCGATCGCGTGAAGGGCCTCGACGCGGGCGCCGACGACTATCTCGTCAAGCC
GTTCGATCTCGACGAACTCGGCGCGCGGATGCGCGCGCTGATCCGCCGGCAGGCCGGGCGCAGCGAGTCGCTGATCCGCC
ACGGCGCGCTGACGCTCGATCCGGCATCGCACCAGGTGACGCTCGACGGCGCGCCGGTCGCGCTGTCCGCGCGCGAATTC
GCGCTGCTCGAGGCGCTGCTCGCGCGGCCGGGCGCCGTGCTGTCGAAGAGCCAGCTCGAGGAGAAGATGTACGGCTGGGG
CGAGGAAATCGGCAGCAACACGGTCGAGGTCTATATCCACGCACTGCGCAAGAAGCTCGGTTCGGACCTGATCCGCAACG
TGCGCGGGCTCGGCTACATGGTCGTCAAGGAAAGCTGA

Protein sequence : 
MDAIPMRILLVEDDRMIAEGVRKALRSDGFAVDWVQDGESALTALGGESYDLLLLDLGLPKRDGIDVLRTLRARGLSLPV
LIVTARDAIADRVKGLDAGADDYLVKPFDLDELGARMRALIRRQAGRSESLIRHGALTLDPASHQVTLDGAPVALSAREF
ALLEALLARPGAVLSKSQLEEKMYGWGEEIGSNTVEVYIHALRKKLGSDLIRNVRGLGYMVVKES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 2e-32 51
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-20 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bmul_0680 YP_001578872.1 two component transcriptional regulator BAC0487 Protein 1e-28 47
Bmul_0680 YP_001578872.1 two component transcriptional regulator BAC0197 Protein 8e-25 45
Bmul_0680 YP_001578872.1 two component transcriptional regulator BAC0083 Protein 3e-22 44
Bmul_0680 YP_001578872.1 two component transcriptional regulator NC_002516.2.879194.p Protein 2e-22 43
Bmul_0680 YP_001578872.1 two component transcriptional regulator BAC0638 Protein 3e-21 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bmul_0680 YP_001578872.1 two component transcriptional regulator VFG0473 Protein 8e-31 47
Bmul_0680 YP_001578872.1 two component transcriptional regulator VFG1390 Protein 2e-29 46
Bmul_0680 YP_001578872.1 two component transcriptional regulator VFG0596 Protein 5e-21 42
Bmul_0680 YP_001578872.1 two component transcriptional regulator VFG1389 Protein 4e-21 41