Gene Information

Name : Bmul_2337 (Bmul_2337)
Accession : YP_001580519.1
Strain :
Genome accession: NC_010084
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2546328 - 2547011 bp
Length : 684 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: ajs:Ajs_1236 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence : 
ATGAAACTGTTGGTGATCGAGGACGAGAACAAGACAGCGGACTACGTGCGCCAGGGCCTCATGGAAGCGGGGTTCGTGGT
GGACCTGGCACGCAATGGCCTGGACGGCCATCACCAGGCCATGAGCGAGACCTACGATCTGGTCATCCTCGACGTCATGC
TGCCGGACGTGGATGGCTGGCGCATCGTTCAATCGCTGCGCGAGGCGGGCAAGCAGGTCCCGGTGCTGTTCCTGACCGCG
CGCGGCGGCGTGGATGACCGCGTGAAGGGCCTGGAACTGGGCGCCGACGACTACCTGGTCAAGCCTTTCGCGTTCTCCGA
GTTGCTCGCGCGCGTGCGCACGCTGCTGCGCCGCGGCAGCGCGCCCAACCACCCCGACCGCATCCAGATCGCCGATCTGC
TGCTCGACCTGCCGCGGCGGCGCGCGACCCGGGCAGGACAGCGCATCAACCTAACCAGCAAGGAGTTCGCCTTGCTCGAA
CTGCTGGCGCGGCGCCAGGGCGAGGTGTTGCCGCGCTCATTGATCGCCTCGCAGGTCTGGGACATGAATTTCGACAGCGA
CAGCAACGTGATCGACGTTGCCATTCGCCGGCTGCGCGCGAAGATCGACGATGCCTTCGATCCCAAGCTCATCCATACGG
TACGGGGCATGGGCTATACGCTGGATGCCCCGGATGCCGACTAA

Protein sequence : 
MKLLVIEDENKTADYVRQGLMEAGFVVDLARNGLDGHHQAMSETYDLVILDVMLPDVDGWRIVQSLREAGKQVPVLFLTA
RGGVDDRVKGLELGADDYLVKPFAFSELLARVRTLLRRGSAPNHPDRIQIADLLLDLPRRRATRAGQRINLTSKEFALLE
LLARRQGEVLPRSLIASQVWDMNFDSDSNVIDVAIRRLRAKIDDAFDPKLIHTVRGMGYTLDAPDAD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-57 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-56 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bmul_2337 YP_001580519.1 two component heavy metal response transcriptional regulator BAC0083 Protein 2e-69 72
Bmul_2337 YP_001580519.1 two component heavy metal response transcriptional regulator BAC0111 Protein 4e-72 69
Bmul_2337 YP_001580519.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-62 69
Bmul_2337 YP_001580519.1 two component heavy metal response transcriptional regulator BAC0197 Protein 5e-62 65
Bmul_2337 YP_001580519.1 two component heavy metal response transcriptional regulator BAC0347 Protein 6e-63 64
Bmul_2337 YP_001580519.1 two component heavy metal response transcriptional regulator BAC0125 Protein 1e-60 62
Bmul_2337 YP_001580519.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-62 61
Bmul_2337 YP_001580519.1 two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 4e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bmul_2337 YP_001580519.1 two component heavy metal response transcriptional regulator VFG0596 Protein 1e-57 58
Bmul_2337 YP_001580519.1 two component heavy metal response transcriptional regulator VFG1389 Protein 3e-34 45
Bmul_2337 YP_001580519.1 two component heavy metal response transcriptional regulator VFG1390 Protein 8e-39 43