Gene Information

Name : Bmul_0122 (Bmul_0122)
Accession : YP_001578314.1
Strain :
Genome accession: NC_010084
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 133424 - 133855 bp
Length : 432 bp
Strand : -
Note : TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM: regulatory protein MerR; Transcription regulator MerR DNA binding; KEGG: bch:Bcen2424_0123 transcriptional regulator, MerR family

DNA sequence :
ATGAAGATCGGCGAATTGGCCAAAGCGGCCCGCTGCACGCCGGAGACGATCCGCTTCTACGAGAAGGAGGGTCTGATGCC
GGATGCGCAGCGTACCGACTCGAACTATCGCAACTACACCGACGTACACCTCGAGCGGCTGCGCTTCATCCGCAACTGCC
GCGCGCTCGACATGGCGCACGACGAAATCCGCGCGCTGCTGCGCCTCACCGACACGCCGGGCGACCGCTGCGATTCGATC
AATGCGCTGCTCGACGAACACATCGGACACGTCGATGCGCGCCTCGCGGAACTCACGCATCTGCGCGATCAGCTCACCGA
ACTGCGGCGGCAATGCGTCGGCGAGCATTCGGTCGAAGACTGCGGCATCGTGCATGGGCTCGCGACGATGGAAACCGTCG
CGCCGGCCGCGAAGCGCACGCATCTCGGCTGA

Protein sequence :
MKIGELAKAARCTPETIRFYEKEGLMPDAQRTDSNYRNYTDVHLERLRFIRNCRALDMAHDEIRALLRLTDTPGDRCDSI
NALLDEHIGHVDARLAELTHLRDQLTELRRQCVGEHSVEDCGIVHGLATMETVAPAAKRTHLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 2e-31 50
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 2e-29 46
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 1e-29 46
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-29 46
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 1e-29 46
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 5e-29 45
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 3e-29 45
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 3e-29 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bmul_0122 YP_001578314.1 MerR family transcriptional regulator BAC0058 Protein 4e-39 56
Bmul_0122 YP_001578314.1 MerR family transcriptional regulator BAC0301 Protein 4e-31 53