Name : rpmF (lhv_1046) Accession : YP_001577398.1 Strain : Lactobacillus helveticus DPC 4571 Genome accession: NC_010080 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L32 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0333 EC number : - Position : 1022563 - 1022751 bp Length : 189 bp Strand : + Note : some L32 proteins have zinc finger motifs consisting of CXXC while others do not DNA sequence : ATGGCAGTTCCTGCAAGACATACTTCTAAACAAAAGAAACGTTCACGTCGTGGTCATATTAAGTTGAGTGTTCCAGCAAT GCACTATGATGCAACTACTGGTGAATACCGCTTAAGCCACCGTGTTTCACCAAAGGGTTATTACAAGGGTCGTCAAGTTG TAAACAACAACGATAACGGCAATAACTAA Protein sequence : MAVPARHTSKQKKRSRRGHIKLSVPAMHYDATTGEYRLSHRVSPKGYYKGRQVVNNNDNGNN |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
rpmF | NP_814315.1 | 50S ribosomal protein L32 | Not tested | Not named | Protein | 5e-10 | 60 |
ef0071 | AAM75276.1 | EF0071 | Not tested | Not named | Protein | 4e-10 | 60 |
rpmF | NP_814351.1 | 50S ribosomal protein L32 | Not tested | Not named | Protein | 1e-09 | 56 |
ef0104 | AAM75307.1 | EF0104 | Not tested | Not named | Protein | 1e-09 | 56 |