Gene Information

Name : rpmF (lhv_1046)
Accession : YP_001577398.1
Strain : Lactobacillus helveticus DPC 4571
Genome accession: NC_010080
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L32
Function : -
COG functional category : J : Translation, ribosomal structure and biogenesis
COG ID : COG0333
EC number : -
Position : 1022563 - 1022751 bp
Length : 189 bp
Strand : +
Note : some L32 proteins have zinc finger motifs consisting of CXXC while others do not

DNA sequence :
ATGGCAGTTCCTGCAAGACATACTTCTAAACAAAAGAAACGTTCACGTCGTGGTCATATTAAGTTGAGTGTTCCAGCAAT
GCACTATGATGCAACTACTGGTGAATACCGCTTAAGCCACCGTGTTTCACCAAAGGGTTATTACAAGGGTCGTCAAGTTG
TAAACAACAACGATAACGGCAATAACTAA

Protein sequence :
MAVPARHTSKQKKRSRRGHIKLSVPAMHYDATTGEYRLSHRVSPKGYYKGRQVVNNNDNGNN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ef0071 AAM75276.1 EF0071 Not tested Not named Protein 4e-10 60
rpmF NP_814315.1 50S ribosomal protein L32 Not tested Not named Protein 5e-10 60
ef0104 AAM75307.1 EF0104 Not tested Not named Protein 1e-09 56
rpmF NP_814351.1 50S ribosomal protein L32 Not tested Not named Protein 1e-09 56