
|
Name : rpmE2 (lhv_0281) Accession : YP_001576801.1 Strain : Lactobacillus helveticus DPC 4571 Genome accession: NC_010080 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L31 type B Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0254 EC number : - Position : 286778 - 287023 bp Length : 246 bp Strand : + Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g DNA sequence : ATGAAACAAGGTATTCATCCAGATTTTCAAAAAGTAGTTTTCATGGACTCAGCAACTGGTGCTAAGTTCTTAGCTGGTTC AACTTTGAAGCCAGAAGAAACTGTTGACTACGAAGGCGAAACTTACCCATTAGTACGTGTTGAAGTTTCATCAGATTCAC ACCCATTCTACACTGGCAAGCAAAAGTTTGCTCAAGCAGATGGTAGAATCGAAAAGTTCAACAAGAAGTACGGCTTGAAG AAGTAA Protein sequence : MKQGIHPDFQKVVFMDSATGAKFLAGSTLKPEETVDYEGETYPLVRVEVSSDSHPFYTGKQKFAQADGRIEKFNKKYGLK K |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmE2 | NP_287095.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 2e-14 | 43 |
| rpmE2 | NP_286687.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 2e-14 | 43 |