Gene Information

Name : Bmul_6173 (Bmul_6173)
Accession : YP_001573626.1
Strain :
Genome accession: NC_010070
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 13338 - 14024 bp
Length : 687 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bch:Bcen2424_3680 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence :
GTGATGCGAATTCTGATTGTCGAGGATGAACCGAAGACGGGCGCGTATCTGCGCAAGGGCCTGACCGAGGCCGGCTACGT
TGTCGACTGGGTCGAGGACGGCATCACGGGCCAGCACCAGGCCGAAACGGAGGAGTACGACCTGCTCGTGCTCGACGTGA
TGCTGCCCGGGCAGGACGGCTGGACGCTGCTGCAGAACCTGCGGCGCAGCAAATCGACGCCCGTGCTGTTCCTCACTGCC
CGTGACGACGTCGGCGATCGCGTGAAGGGGCTCGAGCTCGGCGCGGACGACTATCTCGCGAAGCCGTTCGACTTCGTCGA
GCTGACCGCGCGCATCAAGTCGATCCTGCGGCGCGGCCAGCCGCGCGATTCGAACACGCTGCGCGCGGCCGATCTCGAAC
TGGACCTGACCCGCCGCAAGGCCACGCGGCAGGGCGACACGATCCTGCTGACCGCGAAGGAGTTCGCGCTGCTGTGGCTG
CTGATGCGCCGCGAAGGGGAGATCCTGCCGCGCGCGACGATCGCGTCGCAGGTATGGGACATGAACTTCAACAGCGACAC
GAACGTCGTCGATTCGGCGATCCGCCGGCTGCGCTCGAAGATCGACGACGCGTACGAACCGAAGCTGATCCACACGGTGC
GCGGCATGGGCTACGTGCTCGAAGCGCGCGGCGGCGCGGCCGCATGA

Protein sequence :
MMRILIVEDEPKTGAYLRKGLTEAGYVVDWVEDGITGQHQAETEEYDLLVLDVMLPGQDGWTLLQNLRRSKSTPVLFLTA
RDDVGDRVKGLELGADDYLAKPFDFVELTARIKSILRRGQPRDSNTLRAADLELDLTRRKATRQGDTILLTAKEFALLWL
LMRREGEILPRATIASQVWDMNFNSDTNVVDSAIRRLRSKIDDAYEPKLIHTVRGMGYVLEARGGAAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-58 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-57 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator BAC0197 Protein 3e-94 86
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator BAC0083 Protein 5e-66 62
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator BAC0125 Protein 5e-68 62
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-59 61
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator BAC0308 Protein 4e-63 59
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator BAC0111 Protein 1e-63 58
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator BAC0347 Protein 6e-59 55
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 7e-36 43
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 7e-36 43
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 7e-36 43
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 7e-36 43
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 7e-36 43
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 7e-36 43
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 7e-36 43
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 7e-36 43
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 2e-30 41
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 2e-33 41
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 1e-33 41
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 1e-33 41
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 1e-33 41
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 2e-33 41
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator AE016830.1.gene1681. Protein 3e-34 41
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 1e-33 41
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 1e-33 41
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 1e-33 41
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 1e-33 41
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 1e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-58 56
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator VFG1390 Protein 1e-37 43
Bmul_6173 YP_001573626.1 two component heavy metal response transcriptional regulator VFG1389 Protein 3e-31 42