Gene Information

Name : SARI_00096 (SARI_00096)
Accession : YP_001569191.1
Strain : Salmonella enterica RSK2980
Genome accession: NC_010067
Putative virulence/resistance : Virulence
Product : cell invasion protein
Function : -
COG functional category : M : Cell wall/membrane/envelope biogenesis
COG ID : COG0741
EC number : -
Position : 92471 - 92953 bp
Length : 483 bp
Strand : -
Note : 'KEGG: bba:Bd1285 1.8e-07 soluble lytic murein transglycosylase K01238; COG: COG0741 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains); Psort location: extracellular, including cell wall, score: 9'

DNA sequence :
ATGCGTTATTTTTTTAGCATCGTAATTTGGTTGATTAGTATAAATACGGCATGGGCTGATTGCTGGCTTCAGGCTGAAAA
AATGTTCAATATTGAATCAGAATTACTTTATGCTATCGCCCAACAGGAATCGGCGATGAAACCTGGTGCCATTGGTCATA
ACCGAGATGGCTCTACCGATATCGGACTGATGCAAATTAATAGCTCCCATATGAAAAGACTGAAAAAAATGGGAATCAGT
GAAAAACAGTTATTACAAGATCCCTGCATTTCGGTAATTGTTGGCGCATCCATTTTATCAGATATGATGAAAATCTACGG
TTATAGCTGGGAGGCCGTTGGTGCTTATAATGCCGGAACGTCACCGCAAAGAGCTGATATAAGAAAACGTTATGCTAAAA
AAATTTGGGAGAATTACAAAAAATTAAAAGAGATGCCAGCAGAAGAGAAGAACAAAAAACTTTCTATCGCGTTAAACAAA
TAA

Protein sequence :
MRYFFSIVIWLISINTAWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDIGLMQINSSHMKRLKKMGIS
EKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPQRADIRKRYAKKIWENYKKLKEMPAEEKNKKLSIALNK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
iagB YP_217796.1 cell invasion protein Virulence SPI-1 Protein 6e-66 93
iagB NP_461798.1 invasion protein precursor Virulence SPI-1 Protein 5e-66 93
iagB NP_457271.1 cell invasion protein Virulence SPI-1 Protein 1e-66 93
iagB NP_806480.1 cell invasion protein Virulence SPI-1 Protein 1e-66 93
unnamed ACU09469.1 putative lytic transglycosylase Not tested LEE Protein 7e-20 46
ECO103_3629 YP_003223486.1 hypothetical protein Not tested LEE Protein 9e-20 46
ECO26_5260 YP_003232142.1 hypothetical protein Not tested LEE Protein 9e-20 46
unnamed AAK26704.1 unknown Not tested LEE Protein 6e-20 46
Z5131 NP_290279.1 hypothetical protein Not tested LEE Protein 1e-19 46
unnamed AAC31524.1 L0045 Not tested LEE Protein 7e-20 46
ECs4579 NP_312606.1 hypothetical protein Not tested LEE Protein 1e-19 46
unnamed AAL57531.1 unknown Not tested LEE Protein 6e-20 46
st13 CAC81851.1 ST13 protein Not tested LEE II Protein 6e-20 46
unnamed CAI43885.1 hypothetical protein Not tested LEE Protein 6e-20 46
ECO111_3763 YP_003236099.1 hypothetical protein Not tested LEE Protein 1e-19 45
unnamed AAC38373.1 rOrf3 Not tested LEE Protein 1e-19 45
unnamed AAL06358.1 unknown Not tested LEE Protein 1e-20 45
ECs3711 NP_311738.1 hypothetical protein Not tested LIM Protein 1e-17 43
etgA AFO66324.1 putative lytic transglycosylase Not tested SESS LEE Protein 2e-23 42
etgA AFO66404.1 putative lytic transglycosylase Not tested SESS LEE Protein 2e-23 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SARI_00096 YP_001569191.1 cell invasion protein VFG0539 Protein 1e-66 93
SARI_00096 YP_001569191.1 cell invasion protein VFG0823 Protein 3e-20 46
SARI_00096 YP_001569191.1 cell invasion protein VFG0719 Protein 4e-20 45
SARI_00096 YP_001569191.1 cell invasion protein VFG0994 Protein 1e-24 42
SARI_00096 YP_001569191.1 cell invasion protein VFG1789 Protein 9e-16 42