Name : SARI_03882 (SARI_03882) Accession : YP_001572818.1 Strain : Salmonella enterica RSK2980 Genome accession: NC_010067 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 3810717 - 3810962 bp Length : 246 bp Strand : + Note : 'COG: NOG23021 non supervised orthologous group; Psort location: mitochondrial, score: 23' DNA sequence : ATGATGCGCTGCCCTTTCTGCCGCACGGCGGCACACGTTCGCACCAGCCGCTATATGTCTGACAGCGTCAAAGAGAGTTA CCTGCAGTGCCAGAATGTGCACTGCTCGGCGACATTCAAAACGCATGAATCCATCTTTGAAGTGATACGTTCGCCGGTCG TCGATGAGAAACCCGCGCCGGTGCCGACAGCCCCTGTGGCACCCCGTCGGGTAAAAGGCTGCTACAGCTCGCCGTTCCGC CATTAA Protein sequence : MMRCPFCRTAAHVRTSRYMSDSVKESYLQCQNVHCSATFKTHESIFEVIRSPVVDEKPAPVPTAPVAPRRVKGCYSSPFR H |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
STY4826 | NP_458904.1 | bacteriophage gene regulatory protein | Not tested | SPI-10 | Protein | 8e-14 | 61 |
STY4600 | NP_458683.1 | putative positive regulator of late gene transcription | Not tested | SPI-7 | Protein | 3e-06 | 46 |
t4294 | NP_807891.1 | positive regulator of late gene transcription | Not tested | SPI-7 | Protein | 3e-06 | 46 |