Gene Information

Name : SARI_03312 (SARI_03312)
Accession : YP_001572286.1
Strain : Salmonella enterica RSK2980
Genome accession: NC_010067
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG0582
EC number : -
Position : 3207340 - 3208599 bp
Length : 1260 bp
Strand : +
Note : 'COG: COG0582 Integrase; Psort location: nuclear, score: 23'

DNA sequence :
ATGCCACTCACCGATACCGCCATCCGCAACGCGAAGCCGCTCGATAAGCCTTACAAACTCAGCGACGCGCAGGGCCTGTA
CCTGCTGATTAAACCTAACGGTTCTAAACTCTGGCACCTCAAGTACCGCTTTGGCGGTAAAGAGAAAAAGCTGGCGTTTG
GCGCTTACCCGACCGTGACGCTGGCGAATGCGCGTAAGCTGCGCGAGGAAGCCAGAGCCGTACTCAGCGCAGGCGACGAT
CCAGGGGTGAAGAAGCAGCAGGAGAAGCAGGCGAAGAAAAGCGGTAATACGTTTGAGGAAGTCGCCCGTAGGTGGCTGGC
AGGGAATATCCGCTGGACGGAGCATCACGCGGCAAAGATCCTGCGCTCGCTGGAGCTGCACGTATTCCCGCTGATCGGCA
ACATCCCCGTCGCCGACCTGAAAACCGCCGACCTACTGATCCCGCTGCGGGTGGCGGAGAAGAAAGGCAATCTGGAGACC
GCCGCTCGGAGCCAGCAGCGCACCACGGCGATCATGCGCTACGCGGTGCAGGAGAGCCTGATCGCCAGCAACCCGGCCAA
CGATCTGACGGGTGCCATCGCGCCGCCGCCGAAAAACCACTACCCCGCCCTGCCGCTGGAGCAGATACCGCAGTTGCTGG
AACGGCTGGAGGGCTACTCCGGCAGGCTGTTAACCCGGCTGGCGGTGCAGCTTAACCTGCTGATCTTTATCCGCTCCAGC
GAACTGCGTTTTGCCCGCTGGACGGAGATCGATCTGGATGGCGCAATGTGGACGATCCCGACGCAGCGTGAGTCCATTCC
GGGCGTGCGCTATTCAGAGCGTGGCGCGAAGATGAAAACGCCGCATCTGGTGCCGCTGTCAAAACAGGCGGTGACGGTGC
TGAAACAGCTAAAGCTGCTGTCCGGCAACAGTGAGCTGTTATTTCCGGGCGACCACGATCCTCGTAAGCCTATGAGCGAA
AACACCATCAATAAGGCGCTGCGGGTGATGGGCTATGACACGAAGGTGGATGTGTGCGGTCATGGCTTCCGCACAATGGC
CTGTAGCGCGCTGATCGAATCCGGGCGCTGGTCGAAAGATGCGGTTGAGCGGCAGATGAGCCATCAGGAACGTAACAACG
TTCGCGCCGCGTATATCCACAAGGCAGAGCACCTCGACGAGCGCACGCAGATGATGCAGTGGTGGTCGGACTATCTCGAC
GCCTGTCGGCAAAAGTTTGTTGCGCCATACCGGTATGACAGACAGGTTCAGGTGGCCTGA

Protein sequence :
MPLTDTAIRNAKPLDKPYKLSDAQGLYLLIKPNGSKLWHLKYRFGGKEKKLAFGAYPTVTLANARKLREEARAVLSAGDD
PGVKKQQEKQAKKSGNTFEEVARRWLAGNIRWTEHHAAKILRSLELHVFPLIGNIPVADLKTADLLIPLRVAEKKGNLET
AARSQQRTTAIMRYAVQESLIASNPANDLTGAIAPPPKNHYPALPLEQIPQLLERLEGYSGRLLTRLAVQLNLLIFIRSS
ELRFARWTEIDLDGAMWTIPTQRESIPGVRYSERGAKMKTPHLVPLSKQAVTVLKQLKLLSGNSELLFPGDHDPRKPMSE
NTINKALRVMGYDTKVDVCGHGFRTMACSALIESGRWSKDAVERQMSHQERNNVRAAYIHKAEHLDERTQMMQWWSDYLD
ACRQKFVAPYRYDRQVQVA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SESS1296_03598 AFO66301.1 bacteriophage integrase Not tested SESS LEE Protein 0.0 91
SESS1635_03816 AFO66367.1 bacteriophage integrase Not tested SESS LEE Protein 0.0 91
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 2e-130 61
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 1e-130 61
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 1e-130 61
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 5e-130 61
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 7e-130 61
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 3e-130 61
intB CAD42017.1 bacteriophage P4 integrase Not tested PAI II 536 Protein 1e-123 61
int AAL51028.1 CP4-like integrase Not tested LEE Protein 2e-131 61
int-phe AAL60261.1 Int-phe Not tested LEE Protein 2e-131 61
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 2e-132 61
int AAK16198.1 Int Not tested PAI-I AL862 Protein 2e-132 61
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 3e-131 61
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 2e-132 61
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 3e-131 61
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 2e-131 61
int AAK00456.1 Int Not tested SHI-1 Protein 2e-122 60
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 2e-130 60
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 5e-128 60
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 8e-129 60
int AAL51003.1 CP4-like integrase Not tested LEE Protein 5e-131 60
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 4e-131 60
int CAC81896.1 integrase Not tested LEE II Protein 1e-122 60
int CAA08754.1 integrase Not tested HPI Protein 1e-122 58
y2393 NP_669700.1 prophage integrase Not tested HPI Protein 4e-122 58
int2 NP_993013.1 integrase Not tested HPI Protein 4e-122 58
int CAB59974.1 integrase Not tested HPI Protein 4e-123 58
int CAA21384.1 - Not tested HPI Protein 4e-122 58
int YP_002346908.1 integrase Not tested HPI Protein 4e-122 58
APECO1_1051 YP_853069.1 phage integrase Not tested PAI IV APEC-O1 Protein 1e-85 57
intB AAD37509.1 P4-like integrase Not tested PAI IV 536 Protein 8e-103 57
int NP_458759.1 bacteriophage integrase Not tested SPI-7 Protein 2e-120 57
int NP_807963.1 bacteriophage integrase Not tested SPI-7 Protein 2e-120 57
STY4821 NP_458899.1 integrase Not tested SPI-10 Protein 8e-118 56
unnamed AAD17660.1 unknown Not tested HPI Protein 1e-118 56
unnamed ABR13507.1 phage integrase Not tested PAGI-6 Protein 1e-104 53
int AAD44730.1 Int Not tested SHI-2 Protein 5e-83 44
aec33 AAW51716.1 Int Not tested AGI-3 Protein 1e-83 44
int CAC39282.1 integrase Not tested LPA Protein 9e-84 44
SF3698 NP_709437.1 integrase Not tested SHI-2 Protein 2e-81 44
int AAD54663.1 Sai integrase Not tested SHI-2 Protein 2e-81 44
S4835 NP_839238.1 integrase Not tested SHI-2 Protein 2e-81 44
int ACU09430.1 integrase Not tested LEE Protein 7e-83 43
intL NP_290239.1 integrase for prophage 933L and the LEE pathogenicity island Not tested LEE Protein 1e-82 43
ECs4534 NP_312561.1 integrase Not tested LEE Protein 1e-82 43
int AAC31482.1 CP4-like integrase Not tested LEE Protein 7e-83 43
unnamed AFX83955.1 integrase Not tested SE-PAI Protein 4e-77 43
ESA_03025 YP_001439090.1 hypothetical protein Not tested Not named Protein 4e-75 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SARI_03312 YP_001572286.1 hypothetical protein VFG0626 Protein 4e-131 61
SARI_03312 YP_001572286.1 hypothetical protein VFG1536 Protein 6e-124 61
SARI_03312 YP_001572286.1 hypothetical protein VFG1693 Protein 3e-129 60
SARI_03312 YP_001572286.1 hypothetical protein VFG0598 Protein 9e-82 44
SARI_03312 YP_001572286.1 hypothetical protein VFG0783 Protein 4e-83 43