Gene Information

Name : SARI_03079 (SARI_03079)
Accession : YP_001572061.1
Strain : Salmonella enterica RSK2980
Genome accession: NC_010067
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 3005196 - 3005519 bp
Length : 324 bp
Strand : -
Note : 'COG: COG2963 Transposase and inactivated derivatives; Psort location: nuclear, score: 23'

DNA sequence :
ATGAAAAAAAGAAATTTCAGCGCAGAGTTTAAACGCGAATCCGCTCAACTGGTTGTTGACCAGAACTACACGGTGGCAGA
TGCCGCCAAAGCTATGGATGCCGGCCTTTCCACAATGACAAGATGGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAA
CACCAAAAGCCTCTCCGATGACACCAGAACAAATCGAAATACGCGAGCAGAAGAAAAAGCTACAACGCAATGAAATGGAA
AACGAAATATTAAAAAACTGTCCATGGGGGAAACCCCGTCCTGAGTCTCAGAAACTCCCCGGAAAAGTTGGCAGGCTAAT
TTAG

Protein sequence :
MKKRNFSAEFKRESAQLVVDQNYTVADAAKAMDAGLSTMTRWVKQLRDERQGKTPKASPMTPEQIEIREQKKKLQRNEME
NEILKNCPWGKPRPESQKLPGKVGRLI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-32 91
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-32 91
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-31 89
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-31 88
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 7e-25 73
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 7e-25 73
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-25 73
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 5e-25 73
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-25 73
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-25 73
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-25 73
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-25 73
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 3e-22 63
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 9e-16 52
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-16 52
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 3e-16 52
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 4e-16 50
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 6e-16 50
unnamed AAC31483.1 L0004 Not tested LEE Protein 4e-16 50
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 6e-16 50
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 3e-16 45
tnpA CAB61575.1 transposase A Not tested HPI Protein 9e-16 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SARI_03079 YP_001572061.1 hypothetical protein VFG1485 Protein 7e-33 91
SARI_03079 YP_001572061.1 hypothetical protein VFG1123 Protein 2e-25 73
SARI_03079 YP_001572061.1 hypothetical protein VFG1553 Protein 1e-22 63
SARI_03079 YP_001572061.1 hypothetical protein VFG0784 Protein 2e-16 50