Gene Information

Name : SARI_02146 (SARI_02146)
Accession : YP_001571165.1
Strain : Salmonella enterica RSK2980
Genome accession: NC_010067
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 2081944 - 2082261 bp
Length : 318 bp
Strand : +
Note : 'KEGG: rha:RHA1_ro08393 0.0066 transposase; COG: COG2963 Transposase and inactivated derivatives; Psort location: nuclear, score: 23'

DNA sequence :
GTGATATTCTCACCTCAACATAAAACAGGTGACTTAATGAACAAAAAAACCAAACGTACATTCACCCCTGAGTTCAGGCT
GGAATGTGCACAGCTGATTGTTGATAAGGGCTACCCATACCGACAAGCCAGTGAAGCGATGAATGTCGGTTCTACCACGC
TTGAGAGCTGGGTACGCCAGATCAGGCGAGAGCGTCAGGGGATTACGCCCTCTGCAACCCCCATTACTCCAGACCAGCAA
CGTATCCGCGAGCTGGAAAAGCAGGTTCGCCGTCTGGAGGAACAAAATACGATATTAAAAAAGCTACCGCGCTCTTGA

Protein sequence :
MIFSPQHKTGDLMNKKTKRTFTPEFRLECAQLIVDKGYPYRQASEAMNVGSTTLESWVRQIRRERQGITPSATPITPDQQ
RIRELEKQVRRLEEQNTILKKLPRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 1e-43 99
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-43 99
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-42 96
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 3e-42 96
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 3e-42 96
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 6e-37 96
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-26 58
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-26 58
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-26 58
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-26 58
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-26 58
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-26 58
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-26 58
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-26 58
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-18 55
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-18 54
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-18 54
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-18 54
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 7e-20 54
tnpA CAB61575.1 transposase A Not tested HPI Protein 2e-19 53
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 4e-17 46
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 4e-17 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SARI_02146 YP_001571165.1 hypothetical protein VFG0784 Protein 8e-43 96
SARI_02146 YP_001571165.1 hypothetical protein VFG1123 Protein 9e-27 58
SARI_02146 YP_001571165.1 hypothetical protein VFG1485 Protein 5e-19 54
SARI_02146 YP_001571165.1 hypothetical protein VFG1553 Protein 2e-17 46