Gene Information

Name : SARI_01562 (SARI_01562)
Accession : YP_001570598.1
Strain : Salmonella enterica RSK2980
Genome accession: NC_010067
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : U : Intracellular trafficking, secretion and vesicular transport
COG ID : COG4794
EC number : -
Position : 1517134 - 1517400 bp
Length : 267 bp
Strand : -
Note : 'COG: COG4794 Type III secretory pathway, component EscS; Psort location: cytoplasmic, score: 23'

DNA sequence :
ATGAACGATTCTGAGCTGACGCAATTTGTAACGCAACTTTTATGGATCGTTCTTTTTACTTCTATGCCGGTGGTGTTAGT
TGCATCGGTAGTTGGTGTCATCGTAAGCCTTGTTCAGGCCTTGACCCAAATACAGGATCAAACTCTACAATTCATGATTA
AATTATTGGCAATTGCAACAACTTTAATGGTTAGCTACCCATGGCTTAGCGGCATTCTTTTGAATTATACTCGTCAAATA
ATGCTACGAATTGGAGAACATGGTTGA

Protein sequence :
MNDSELTQFVTQLLWIVLFTSMPVVLVASVVGVIVSLVQALTQIQDQTLQFMIKLLAIATTLMVSYPWLSGILLNYTRQI
MLRIGEHG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ssaS YP_216428.1 secretion system apparatus protein SsaS Virulence SPI-2 Protein 1e-26 99
ssaS NP_460385.1 type III secretion system apparatus protein Virulence SPI-2 Protein 1e-26 99
ssaS CAA68200.1 secretion system apparatus, SsaS Virulence SPI-2 Protein 1e-26 99
ssaS NP_456108.1 putative type III secretion protein Virulence SPI-2 Protein 2e-26 98
ssaS NP_805091.1 type III secretion protein Virulence SPI-2 Protein 2e-26 98
escS AFO66341.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 1e-08 47
escS AFO66401.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 1e-08 47
lscS AAO18039.1 LscS Virulence TTSS locus Protein 9e-10 46
hrcS AAB06006.1 HrcS Virulence Hrp PAI Protein 0.002 46
escS AAK26701.1 EscS Virulence LEE Protein 1e-07 45
escS YP_003223489.1 T3SS structure protein EscS Virulence LEE Protein 2e-07 45
escS AAL57528.1 EscS Virulence LEE Protein 1e-07 45
escS YP_003232139.1 T3SS structure protein EscS Virulence LEE Protein 2e-07 45
escS CAC81848.1 EscS protein Virulence LEE II Protein 1e-07 45
escS CAI43888.1 EscS protein Virulence LEE Protein 1e-07 44
hrcS AAT96304.1 HrcS Virulence S-PAI Protein 0.10 44
hrcS AAT96344.1 HrcS Virulence S-PAI Protein 0.10 44
hrcS ABA47280.1 HrcS Virulence S-PAI Protein 0.020 44
hrcS AAT96263.1 HrcS Virulence S-PAI Protein 0.10 44
unnamed AAL06355.1 EscS Virulence LEE Protein 1e-07 43
ECs4582 NP_312609.1 EscS Virulence LEE Protein 3e-07 43
escS AAC38370.1 EscS Virulence LEE Protein 2e-07 43
escS AAC31527.1 L0048 Virulence LEE Protein 2e-07 43
escS ACU09472.1 hypothetical protein Not tested LEE Protein 2e-07 43
escS YP_003236102.1 T3SS structure protein EscS Virulence LEE Protein 3e-07 43
escS NP_290282.1 hypothetical protein Virulence LEE Protein 3e-07 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SARI_01562 YP_001570598.1 hypothetical protein VFG0520 Protein 4e-27 99
SARI_01562 YP_001570598.1 hypothetical protein VFG0395 Protein 2e-11 52
SARI_01562 YP_001570598.1 hypothetical protein VFG0187 Protein 3e-05 46
SARI_01562 YP_001570598.1 hypothetical protein VFG0043 Protein 8e-07 44
SARI_01562 YP_001570598.1 hypothetical protein VFG0716 Protein 9e-08 43
SARI_01562 YP_001570598.1 hypothetical protein VFG0826 Protein 9e-08 43
SARI_01562 YP_001570598.1 hypothetical protein VFG2132 Protein 3e-05 43