Gene Information

Name : Pmob_0875 (Pmob_0875)
Accession : YP_001567921.1
Strain : Petrotoga mobilis SJ95
Genome accession: NC_010003
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 929593 - 930321 bp
Length : 729 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: tma:TM1655 response regulator DrrA

DNA sequence :
GTGGCAAAAAAAAGTATTATGATAGTAGAAGACGATCCGGCGATCTCTGAAATGTTATCTTTGAACTTGACCAAAGAAGG
TTACGAAGTAATAACGGCTGTGTCTGCTGATGAGGCTTTAAAGAAATTAGAGGAAAAAGATACCGACTTTTTCATAGTGG
ATATTATGTTACCAGGTTCAATGGATGGATTTGATTTAATTAGAATCTTGAAATCCAGCGAAGATTATCGCAATACGCCC
GTACTCATATTGAGTGCCAAAGATGATGCTGCTGATAAAGTAGCTGGGTTAGAACTTGGTAGCGATGATTATGTCACTAA
ACCTTTTAATGTAAGAGAACTAATTGCAAGAATTAAAAGCATATTTAGGAGACAAGCTGCATCAGCTCAAATGAAAGAAG
AAGGACCCAAAAAAATTACAGCTAAAGATTTAATTATCGACACTGAAAGATTAGAAGTTTGGGTAGGGGGAAATCCAGTC
AGCCTTACCCCGTTGGAGTTCGATTTGTTAGTTTTTCTTGCTAAAAATGAAGGAAAAGTCTTTAGTCGAGATGTATTGTT
GGATAAATTGTGGGGTTATGACTACTACGGAGATACAAGAACAGTAGACGTTCATATCAGAAGGTTGAGAACAAAGATCG
AAGAAGATCCTTCTAATCCAAAATACATAATTACAGTAAGAGGGAAAGGATACAAATTCAGAGATCCTGGAAAGGAAAGA
AACTACTAA

Protein sequence :
MAKKSIMIVEDDPAISEMLSLNLTKEGYEVITAVSADEALKKLEEKDTDFFIVDIMLPGSMDGFDLIRILKSSEDYRNTP
VLILSAKDDAADKVAGLELGSDDYVTKPFNVRELIARIKSIFRRQAASAQMKEEGPKKITAKDLIIDTERLEVWVGGNPV
SLTPLEFDLLVFLAKNEGKVFSRDVLLDKLWGYDYYGDTRTVDVHIRRLRTKIEEDPSNPKYIITVRGKGYKFRDPGKER
NY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-42 45
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-42 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pmob_0875 YP_001567921.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-46 48
Pmob_0875 YP_001567921.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-47 47
Pmob_0875 YP_001567921.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-52 44
Pmob_0875 YP_001567921.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-45 43
Pmob_0875 YP_001567921.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-45 43
Pmob_0875 YP_001567921.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-45 43
Pmob_0875 YP_001567921.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-45 43
Pmob_0875 YP_001567921.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-45 43
Pmob_0875 YP_001567921.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-45 43
Pmob_0875 YP_001567921.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-45 43
Pmob_0875 YP_001567921.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-45 43
Pmob_0875 YP_001567921.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-45 43
Pmob_0875 YP_001567921.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-45 43
Pmob_0875 YP_001567921.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-40 43
Pmob_0875 YP_001567921.1 two component transcriptional regulator BAC0125 Protein 9e-34 42
Pmob_0875 YP_001567921.1 two component transcriptional regulator NC_012469.1.7686381. Protein 5e-42 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pmob_0875 YP_001567921.1 two component transcriptional regulator VFG1702 Protein 9e-43 45
Pmob_0875 YP_001567921.1 two component transcriptional regulator VFG1563 Protein 6e-43 44
Pmob_0875 YP_001567921.1 two component transcriptional regulator VFG1386 Protein 1e-39 42
Pmob_0875 YP_001567921.1 two component transcriptional regulator VFG1389 Protein 8e-32 41