Gene Information

Name : Daci_0486 (Daci_0486)
Accession : YP_001561517.1
Strain : Delftia acidovorans SPH-1
Genome accession: NC_010002
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 519001 - 519408 bp
Length : 408 bp
Strand : +
Note : TIGRFAM: Hg(II)-responsive transcriptional regulator; PFAM: regulatory protein MerR; Transcription regulator MerR DNA binding; KEGG: ajs:Ajs_1301 putative transcriptional regulator, MerR family

DNA sequence :
ATGGAAAGCGCCTCGGACAATCTGACCATCGGCGCCTTTGCCAAGGCGGCCACAGTCAATGTGGAGACGATCCGGTTCTA
TCAGCTCAAGGGCTTGTTGCCCCAGCCGGAGCGGGCCTACGGCCGCATCCGCCGCTACGGGCCGGCAGATGTGGCGCGGG
TGAAGTTCGTGAAGTCAGCCCAGCGCCTGGGGTTCAGCCTGGATGAAATCGGCCAGCTTCTGAAACTTGAGGACGGCACC
CATTGCAATGAGGCGGCGGAGCTGGCCTCGCTGCGGCTGGCCGATGTGCGCGCCCGCCTGGTGGACCTCACACGGATTGA
GGCGGCATTGTCGAAATTGGTGGGTGAATGCGACGCGCACCATGGCAATGTGTCCTGCCCGCTGATCGCGGCATTGCACT
GCTGTTGA

Protein sequence :
MESASDNLTIGAFAKAATVNVETIRFYQLKGLLPQPERAYGRIRRYGPADVARVKFVKSAQRLGFSLDEIGQLLKLEDGT
HCNEAAELASLRLADVRARLVDLTRIEAALSKLVGECDAHHGNVSCPLIAALHCC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-53 88
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 4e-43 70
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 5e-43 70
merR ACK44535.1 MerR Not tested SGI1 Protein 1e-42 69
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 1e-42 69
merR AFG30124.1 MerR Not tested PAGI-2 Protein 1e-42 69
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-42 69
merR AGK07025.1 MerR Not tested SGI1 Protein 4e-42 68
merR AGK07083.1 MerR Not tested SGI1 Protein 4e-42 68
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 1e-42 67
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 1e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Daci_0486 YP_001561517.1 MerR family transcriptional regulator BAC0688 Protein 1e-43 72
Daci_0486 YP_001561517.1 MerR family transcriptional regulator BAC0687 Protein 7e-43 70
Daci_0486 YP_001561517.1 MerR family transcriptional regulator BAC0683 Protein 2e-44 70
Daci_0486 YP_001561517.1 MerR family transcriptional regulator BAC0232 Protein 7e-43 70
Daci_0486 YP_001561517.1 MerR family transcriptional regulator BAC0686 Protein 3e-44 69
Daci_0486 YP_001561517.1 MerR family transcriptional regulator BAC0684 Protein 1e-44 69
Daci_0486 YP_001561517.1 MerR family transcriptional regulator BAC0689 Protein 4e-43 69