|
Name : Daci_0484 (Daci_0484) Accession : YP_001561515.1 Strain : Delftia acidovorans SPH-1 Genome accession: NC_010002 Putative virulence/resistance : Resistance Product : mercuric transport protein periplasmic protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 518288 - 518566 bp Length : 279 bp Strand : - Note : TIGRFAM: mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein; KEGG: ajs:Ajs_1299 mercuric transport protein periplasmic component DNA sequence : GTGAAGAAACTTGCCACCGCTATTGCCCTGGCCGTTACCCTGGGCGCTCCGGCGTGGGCCGCCACCAAGACCGTCACACT GTCGGTGCCCGATATGACCTGCGCGTCGTGTCCGATCACGGTCAAGATGGCCCTGTTCAAGGTGGCCGGGGTCCAGAAGA CCGAGGTCAGCTATGAAAAGCGGGAAGCCGTCGTGACCTTCGACGATGCCAAGACCAACGCCGGGGCCTTGGCCAAGGCC ACCGCAAACGCGGGCTACCCCGCCACCGTCAAGCAGTGA Protein sequence : MKKLATAIALAVTLGAPAWAATKTVTLSVPDMTCASCPITVKMALFKVAGVQKTEVSYEKREAVVTFDDAKTNAGALAKA TANAGYPATVKQ |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merP | AAN62179.1 | periplasmic mercuric ion binding protein MerP | Not tested | PAGI-2(C) | Protein | 9e-17 | 84 |
| unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 2e-17 | 73 |
| merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 2e-14 | 72 |
| merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 1e-14 | 72 |
| merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 6e-15 | 70 |
| merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 6e-15 | 70 |
| merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 6e-15 | 70 |
| merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 6e-15 | 70 |
| merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 9e-15 | 70 |
| merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 6e-15 | 70 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Daci_0484 | YP_001561515.1 | mercuric transport protein periplasmic protein | BAC0678 | Protein | 3e-14 | 68 |
| Daci_0484 | YP_001561515.1 | mercuric transport protein periplasmic protein | BAC0679 | Protein | 7e-14 | 68 |
| Daci_0484 | YP_001561515.1 | mercuric transport protein periplasmic protein | BAC0231 | Protein | 1e-13 | 67 |
| Daci_0484 | YP_001561515.1 | mercuric transport protein periplasmic protein | BAC0675 | Protein | 4e-12 | 65 |
| Daci_0484 | YP_001561515.1 | mercuric transport protein periplasmic protein | BAC0674 | Protein | 5e-14 | 56 |
