Gene Information

Name : Daci_0451 (Daci_0451)
Accession : YP_001561482.1
Strain : Delftia acidovorans SPH-1
Genome accession: NC_010002
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 482085 - 482777 bp
Length : 693 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: ajs:Ajs_1236 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence :
ATGAAGCTGTTGGTCGTTGAAGACGAGAACAAGACGGCGGATTACGTCCGCCAAGGTCTCATGGAGGCAGGGTTCGTCGT
GGATCTGGCGCGTAACGGATTGGACGGACACCACTTGGCCATGAGCGAGACCTACGATTTGGTGGTCTTGGATGTCATGC
TGCCGGATGTCGATGGCTGGCGCATCGTGCGTTCGCTGCGAGATGCTGGCAAACAAGTCCCTGTGCTATTTCTAACCGCA
CGTGGCAGCGTAGATGACCGCGTCAAGGGGTTGGAACTGGGGGCAGACGACTATCTCGTCAAGCCGTTCGCGTTCTCGGA
ATTGCTGGCGCGGGTGCGGACGCTGCTGCGACGCGGAAGCGCTCCGAGCCAGCCTGATCGCATCCAAGTTGCCGATTTGG
TGCTGGACTTGCCGCGCCGACGTGCAACGCGCGCTGGTCAGCGCATCAATCTCACCAGCAAGGAGTTCGCGTTGCTCGAA
CTGCTGGCACGCCGACAGGGTGAAGTTCTGCCGCGTTCGTTGATTGCGTCTCAGGTATGGGACATGAATTTCGACAGCGA
CAGCAACGTCATTGATGTGGCCATCCGTCGTCTGCGCGCAAAGATCGACGATGCGTTCAATCCAAAGCTCATCCACACTG
TACGTGGCATGGGATACACGCTCGATGCGCCTGATGATGACCTCGCGCCATAA

Protein sequence :
MKLLVVEDENKTADYVRQGLMEAGFVVDLARNGLDGHHLAMSETYDLVVLDVMLPDVDGWRIVRSLRDAGKQVPVLFLTA
RGSVDDRVKGLELGADDYLVKPFAFSELLARVRTLLRRGSAPSQPDRIQVADLVLDLPRRRATRAGQRINLTSKEFALLE
LLARRQGEVLPRSLIASQVWDMNFDSDSNVIDVAIRRLRAKIDDAFNPKLIHTVRGMGYTLDAPDDDLAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-54 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-54 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator BAC0083 Protein 2e-68 71
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator BAC0111 Protein 3e-72 70
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator BAC0638 Protein 2e-60 67
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator BAC0347 Protein 7e-63 65
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator BAC0197 Protein 2e-60 65
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator BAC0125 Protein 3e-59 61
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator BAC0308 Protein 1e-60 60
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 3e-27 42
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator BAC0487 Protein 6e-26 41
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 6e-30 41
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 6e-30 41
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 6e-30 41
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 6e-30 41
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 6e-30 41
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 6e-30 41
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 6e-30 41
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 6e-30 41
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 4e-28 41
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 4e-28 41
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 4e-28 41
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 4e-28 41
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 4e-28 41
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 4e-28 41
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 4e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator VFG0596 Protein 4e-55 58
Daci_0451 YP_001561482.1 two component heavy metal response transcriptional regulator VFG1390 Protein 3e-38 45