Gene Information

Name : Daci_1091 (Daci_1091)
Accession : YP_001562121.1
Strain : Delftia acidovorans SPH-1
Genome accession: NC_010002
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1208765 - 1209463 bp
Length : 699 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mpt:Mpe_A1629 two-component response regulator

DNA sequence :
ATGCTCTGCATGAAAGTCCTGGTCATCGAAGACGAAATCAAGCTGGCCGACTACCTCCGCAAGGGCCTGACCGAGGAGGG
GTTCGTGGTCGATGTCGCGCACGACGGCATCGACGGCCTGCACCTGGCCACCGAGCTGGCCTACGACCTCATCGTGCTCG
ACGGCATGCTGCCCGGCATCGACGGCCTGGCCGTGCTGGCGGCGCTGCGCCAGTCGCGCCAGACGCCGGTGCTGATGCTG
ACGGCGCGCGGCCAGGTGGAGGACCGCGTGCGCGGCCTGCAGGGCGGTGCCGACGACTACCTGGTCAAGCCCTTTGCCTT
CTCCGAACTGGTGGCGCGCATGCATGTGCTGCTGCGCCGCAGTGTCGGCACGGCGCATCCGGCGGCCGAGGCCACCATGC
TGCGCATGGCTGACCTGGAGCTGGACCTGATCCGCCGACGCGCCACGCGCGCCGGCCAGCGCCTGGACCTCACGGCCAAG
GAATTCAACCTGCTGAGCCTGCTGCTGCGCCGCCAGGGCGAGGTGCTGTCGCGCACCGAGCTGGCCTCCCAGGTCTGGGA
CATGAACTTCGACAGCGAGACCAACGTGGTCGAGGTCGCCGTGCGCCGCCTGCGCCTGAAGCTGGACCAGCCCTTCGAGC
AGCCCCTGCTGCACACGGTGCGCGGCATGGGCTATGTGCTGGAGTCGCGCGCACCGTGA

Protein sequence :
MLCMKVLVIEDEIKLADYLRKGLTEEGFVVDVAHDGIDGLHLATELAYDLIVLDGMLPGIDGLAVLAALRQSRQTPVLML
TARGQVEDRVRGLQGGADDYLVKPFAFSELVARMHVLLRRSVGTAHPAAEATMLRMADLELDLIRRRATRAGQRLDLTAK
EFNLLSLLLRRQGEVLSRTELASQVWDMNFDSETNVVEVAVRRLRLKLDQPFEQPLLHTVRGMGYVLESRAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-57 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-56 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator BAC0197 Protein 1e-66 62
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator BAC0125 Protein 1e-64 60
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-53 60
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator BAC0083 Protein 1e-58 59
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator BAC0111 Protein 9e-60 56
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator BAC0308 Protein 5e-56 54
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator BAC0347 Protein 2e-54 51
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 2e-34 44
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 2e-33 43
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator CP001918.1.gene5135. Protein 6e-25 42
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator BAC0533 Protein 5e-28 42
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator NC_002695.1.915041.p Protein 4e-28 42
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator CP000647.1.gene4257. Protein 5e-28 42
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator CP000034.1.gene3834. Protein 4e-28 42
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator CP001138.1.gene4273. Protein 3e-28 42
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 8e-37 41
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 8e-37 41
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 8e-37 41
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 8e-37 41
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 8e-37 41
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 8e-37 41
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 8e-37 41
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 8e-37 41
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator HE999704.1.gene2815. Protein 4e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator VFG0596 Protein 3e-57 55
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator VFG1389 Protein 2e-38 48
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator VFG1390 Protein 2e-41 44
Daci_1091 YP_001562121.1 two component heavy metal response transcriptional regulator VFG1386 Protein 6e-36 42