Gene Information

Name : Cphy_1954 (Cphy_1954)
Accession : YP_001559061.1
Strain : Clostridium phytofermentans ISDg
Genome accession: NC_010001
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2411187 - 2411876 bp
Length : 690 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: amt:Amet_2325 two component transcriptional regulator, winged helix family

DNA sequence : 
TTGAGTAAAAAGGTGCTTGTAGTAGATGATGAAAAATTAATTGTTAAGGGAATTCGCTTTTCCCTCGAACAAGATGGCAT
GGAAGTTGATTGTGCTTATGATGGTGAGGAAGCACTCGTTTTTGCGAAACAAAAAGAATATGATGTTATTCTTCTTGATG
TTATGCTTCCAAGAATGAATGGGTTTGAAGTATGCCAGCAGATACGTGAATTTTCTAATATGCCAGTCATCATGTTAACG
GCTAAAGGTGATGATATGGATAAGATTCTAGGACTAGAATATGGTGCAGATGATTATATTACTAAGCCATTTAATATTTT
AGAAGTAAAAGCTAGAATCAAAGCAATTATGAGAAGAAATACAAGAAAGGCTTCAGAAGCAGAAGCATCTAAGACGATTG
TCTTTGGTGATCTAAAGATTGATAGTGAGAGTCGCCGTGTATTTATTTCAGAAAAAGAAATTAATCTTACTGCGAAAGAA
TTTGATGTACTAGAATTACTAGTTCTTAATCCGAATAAAGTATACAGCAGAGAAAATTTATTAAACATCGTATGGGGTTA
TGACTATCCAGGCGATGTCAGAACAGTGGATGTGCATATCCGCCGCTTAAGAGAGAAGATTGAAGAAAATCCTAGCGAGC
CTAAGTATGTACATACTAAATGGGGTGTTGGTTATTATTTCAAAAATTAA

Protein sequence : 
MSKKVLVVDDEKLIVKGIRFSLEQDGMEVDCAYDGEEALVFAKQKEYDVILLDVMLPRMNGFEVCQQIREFSNMPVIMLT
AKGDDMDKILGLEYGADDYITKPFNILEVKARIKAIMRRNTRKASEAEASKTIVFGDLKIDSESRRVFISEKEINLTAKE
FDVLELLVLNPNKVYSRENLLNIVWGYDYPGDVRTVDVHIRRLREKIEENPSEPKYVHTKWGVGYYFKN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-39 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cphy_1954 YP_001559061.1 two component transcriptional regulator HE999704.1.gene2815. Protein 9e-46 48
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_012469.1.7685629. Protein 4e-49 47
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-46 47
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-46 47
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-46 47
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-46 47
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-46 47
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-46 47
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-46 47
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-46 47
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-46 47
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-46 47
Cphy_1954 YP_001559061.1 two component transcriptional regulator AM180355.1.gene1830. Protein 2e-39 46
Cphy_1954 YP_001559061.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 2e-37 46
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-46 45
Cphy_1954 YP_001559061.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 1e-34 45
Cphy_1954 YP_001559061.1 two component transcriptional regulator AE016830.1.gene1681. Protein 4e-44 45
Cphy_1954 YP_001559061.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 5e-43 45
Cphy_1954 YP_001559061.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-38 44
Cphy_1954 YP_001559061.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 5e-41 44
Cphy_1954 YP_001559061.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-40 44
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-36 43
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-36 43
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-36 43
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-36 43
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-36 43
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-36 43
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-36 43
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-36 43
Cphy_1954 YP_001559061.1 two component transcriptional regulator BAC0125 Protein 2e-35 43
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 3e-39 42
Cphy_1954 YP_001559061.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 3e-39 42
Cphy_1954 YP_001559061.1 two component transcriptional regulator CP000675.2.gene1535. Protein 1e-37 41
Cphy_1954 YP_001559061.1 two component transcriptional regulator AF253562.2.orf0.gene Protein 5e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cphy_1954 YP_001559061.1 two component transcriptional regulator VFG1702 Protein 2e-39 41